KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20210Help
Entry
TCCBUS3UF1_20210  CDS       T01866                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCCBUS3UF1_20210
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_20210
  Amino acid metabolism
   00310 Lysine degradation
    TCCBUS3UF1_20210
Enzymes [BR:thc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TCCBUS3UF1_20210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020744..2021940)
Genome map
AA seq 398 aa AA seqDB search
MQELSVPSVGESIVEVEIGAWLKREGEAFAQDEPLVELITDKATLELPAPFAGTLKQILK
RTGETARVGEAIALLEAGVAAAAPAPKPPVEAAEAAPAPEGPLAMPAAERLMREKGVSPT
EVQGTGLGGRILKEDVARHLEARQVPEPPAYAPPPAPAPASPDKPWRVSEAVPMTPLRRR
IAERLLLARQTTAMLTTFNEADMSAVMALRKELGEAFQKKHGVKLGFMSFFVKAVVQALK
EIPELNAEIRDNTIVYHRYYDIGIAVGGGEGLVVPVLRDADRLSFAEIERQIADFAERAR
SKKLKPEELMGGTFTITNGGIYGSLNSTPLLNPPQVGILGMHAIQERPVAREGQVVIRPM
MYLALSYDHRIVDGREAVTFLRRVKELIENPVRLLLEV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaactcagcgtgccctccgtgggcgagagcatcgtggaagtggagatcggcgcc
tggctgaagcgggagggggaggccttcgcccaggacgagcccctggtggagctcatcacc
gacaaggctaccctggagctccccgcccccttcgccggtaccctaaagcagatcctgaag
cgcaccggggaaacggcccgggtgggggaggccatcgccctcctcgaggcgggggtggcg
gcggctgcccccgcccccaagccccccgtggaggcggcggaggcggccccagccccggag
ggtcctttggccatgcctgccgccgaacggctcatgcgggagaagggggtttccccgacg
gaggtccagggcacgggcctgggagggcggatcctcaaggaggacgtggcccgccacctg
gaagcccgccaggtccctgagcctccggcctacgccccgcccccggccccggcgccagcc
tccccggacaagccctggcgggtgagcgaggccgtccccatgacccccctgcgccgccgc
atcgccgagcgcctcctcctggcccggcagaccacggccatgctcaccaccttcaacgag
gccgatatgtccgcggtcatggcccttaggaaggaactcggggaggctttccagaagaag
cacggggtgaagctgggcttcatgagcttcttcgtcaaggccgtggtccaggccctgaag
gagatccccgagctcaacgccgagatccgcgacaacaccatcgtctaccaccgctactac
gacatcggcatcgccgtgggcggcggggaggggctggtggtcccggtcctccgcgatgct
gaccgcctttccttcgccgagatcgagcggcagatcgccgacttcgccgagcgggcccgc
agcaagaagctcaagcccgaggagctcatggggggcaccttcaccatcaccaacgggggg
atttacggctccttgaactccacccccctcctcaacccgccccaggtggggatcctgggc
atgcacgccatccaggagcggcccgtggcccgggagggccaggtggtgatccggcccatg
atgtacctggccctctcctacgaccaccgcatcgtggacgggcgggaggcggtgaccttc
ctgcggcgggtgaaggagctcatcgagaacccggtgcggcttctcctggaggtctga

DBGET integrated database retrieval system