KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20240Help
Entry
TCCBUS3UF1_20240  CDS       T01866                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:thc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TCCBUS3UF1_20240
Enzymes [BR:thc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     TCCBUS3UF1_20240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2025484..2026059
Genome map
AA seq 191 aa AA seqDB search
MVRYLKGVVLRKGEGSFLLLVGGVGFQVQAPPSFVQGLREGEEVAVHTHLQLKEEGLALY
GFPEEESLSLFELLLSVNGVGPKAALSLLSALPPRLLAQALAEGDVRLLTSASGVGRKLA
ERIALELKGKVPPHLAIGAKVESAAAEEAVLALAALGFKEGQARAVVLDLLAQNPGAKAQ
ELIKEALKRLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggtccgctacctcaagggcgtggtcctgcgcaagggggaagggagcttcctcctcctg
gtggggggggtggggttccaggtgcaggcccccccttccttcgtccagggcctgcgggaa
ggggaagaggtggcggtccacacccacctccagctcaaggaggagggcttggccctctat
ggcttccccgaggaggaaagcttaagcctctttgaactcctcctctccgtgaacggggtg
gggcccaaggccgccctttccctcctctccgcccttccccccaggcttctggcccaggcc
ctggcggaaggggacgtaaggctcctcacctcagccagcggggtgggaaggaagctggcg
gaaaggatcgccctggagctcaagggcaaggtgccgccccacctggccattggggcaaag
gtggaaagcgccgccgccgaggaggccgtcttggccctggccgccttgggcttcaaggag
ggccaggcccgggccgtggtcctggacctcctggcccaaaacccaggggccaaggcccag
gagctcatcaaggaggccctgaagcgcctgcgctag

DBGET integrated database retrieval system