KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20450Help
Entry
TCCBUS3UF1_20450  CDS       T01866                                 

Definition
Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCCBUS3UF1_20450
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_20450
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_20450
   00620 Pyruvate metabolism
    TCCBUS3UF1_20450
Enzymes [BR:thc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TCCBUS3UF1_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043328..2044689
Genome map
AA seq 453 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVAEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLVKKL
AREGEVVKVHAPIALLAEPGEGVEPPVQAREERSIVEPGLPAKEEKEDLSLFKPDPTQVA
VKNPFLSTPPTPEAPKGPGGRVLAVPAARKLARELGIPIEAVPGSGPLGRVRVEDVRAYA
AKQGASRPAPPPQEAPKEAPSLPPGFPPPPRYTPPKGYEGLEERVPLRGIRRTIAHGLWQ
SHLYTVRTLNVDEADLTELVALRERLKPEAERQGVRLTYLPFIAKAVVRALKKFPMLNAS
LDEERQEIVYKRYYHLGLAVATERGLIVPVLRDADRKSILELAQEITELSAKAREGRLSP
EEVTGSTFTITNIGSVGATLSFPIINLPEAAILGVHSIRKRPWVMPDGSIQARDIMYLSL
SFDHRLVDGAEAARFTREVIRLLENPEVLLLEM
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgaactcgccgaaagcgtggtggaaggcgagatcctc
aagtggctggtggcggaaggggactacctcaagaaggaccaacccttcgtggaggtgatg
acggacaaggtgacggtggagctcccctccccctacgaaggggtgctggtgaaaaagctg
gcgagggagggggaggtggtcaaggtccacgcccctatcgccctcctcgccgagccgggg
gaaggggtggaaccccctgtgcaggcccgggaggagcgctccatcgtggagccggggttg
cccgccaaggaggaaaaggaggacctctccctcttcaagcccgaccccacccaggtggcg
gtgaaaaaccccttcctctccaccccccctacccccgaagcgcctaagggtcccgggggg
cgggtcctggccgtccccgccgcccgcaagctggcccgggagctagggatccccatagag
gccgtgcccggctccgggcccttaggaagggtgcgggtggaggacgtgcgggcttacgcc
gccaagcagggggcctcgaggccagccccacccccccaggaagcccccaaggaggccccc
agcctccctccaggcttccctcccccgccccggtacaccccccccaaggggtacgagggg
ctggaggagcgcgtccccctaaggggaatccgccgcaccatcgcccatggcctctggcaa
agccacctctacaccgtgcgcaccctcaacgtggacgaggccgacctcacggagctggtg
gccctgcgggagcgcctgaagcccgaggccgagcgccagggggtaaggctcacctacctg
cccttcatcgccaaggcggtggtgcgggccctgaagaagttccccatgctcaacgccagc
ctggacgaggagcggcaggagatcgtctacaagcgctactaccacctgggcctagccgtg
gccacggaacgggggctcatcgtccccgtgttgcgggatgcggaccggaaaagcatcctg
gaactcgcccaggagatcaccgagctctcggccaaggcccgggaggggcggctttcccct
gaggaggtgacgggctccaccttcaccattaccaacatcggctccgtgggggccaccctg
agcttccccatcatcaaccttcccgaggccgccatcctgggggtgcactccatccgcaag
cgcccctgggtcatgcccgatggctccatccaggcccgggacatcatgtacctctccctt
tcctttgaccaccgcctggtggacggggccgaggcggccaggttcacccgggaggtgatc
cggcttttggagaaccccgaggttctcctcctggaaatgtag

DBGET integrated database retrieval system