KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20450Help
Entry
TCCBUS3UF1_20450  CDS       T01866                                 

Definition
Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:thc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thc00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:thc00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:thc00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043328..2044689
Genome map
AA seq 453 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVAEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLVKKL
AREGEVVKVHAPIALLAEPGEGVEPPVQAREERSIVEPGLPAKEEKEDLSLFKPDPTQVA
VKNPFLSTPPTPEAPKGPGGRVLAVPAARKLARELGIPIEAVPGSGPLGRVRVEDVRAYA
AKQGASRPAPPPQEAPKEAPSLPPGFPPPPRYTPPKGYEGLEERVPLRGIRRTIAHGLWQ
SHLYTVRTLNVDEADLTELVALRERLKPEAERQGVRLTYLPFIAKAVVRALKKFPMLNAS
LDEERQEIVYKRYYHLGLAVATERGLIVPVLRDADRKSILELAQEITELSAKAREGRLSP
EEVTGSTFTITNIGSVGATLSFPIINLPEAAILGVHSIRKRPWVMPDGSIQARDIMYLSL
SFDHRLVDGAEAARFTREVIRLLENPEVLLLEM
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgaactcgccgaaagcgtggtggaaggcgagatcctc
aagtggctggtggcggaaggggactacctcaagaaggaccaacccttcgtggaggtgatg
acggacaaggtgacggtggagctcccctccccctacgaaggggtgctggtgaaaaagctg
gcgagggagggggaggtggtcaaggtccacgcccctatcgccctcctcgccgagccgggg
gaaggggtggaaccccctgtgcaggcccgggaggagcgctccatcgtggagccggggttg
cccgccaaggaggaaaaggaggacctctccctcttcaagcccgaccccacccaggtggcg
gtgaaaaaccccttcctctccaccccccctacccccgaagcgcctaagggtcccgggggg
cgggtcctggccgtccccgccgcccgcaagctggcccgggagctagggatccccatagag
gccgtgcccggctccgggcccttaggaagggtgcgggtggaggacgtgcgggcttacgcc
gccaagcagggggcctcgaggccagccccacccccccaggaagcccccaaggaggccccc
agcctccctccaggcttccctcccccgccccggtacaccccccccaaggggtacgagggg
ctggaggagcgcgtccccctaaggggaatccgccgcaccatcgcccatggcctctggcaa
agccacctctacaccgtgcgcaccctcaacgtggacgaggccgacctcacggagctggtg
gccctgcgggagcgcctgaagcccgaggccgagcgccagggggtaaggctcacctacctg
cccttcatcgccaaggcggtggtgcgggccctgaagaagttccccatgctcaacgccagc
ctggacgaggagcggcaggagatcgtctacaagcgctactaccacctgggcctagccgtg
gccacggaacgggggctcatcgtccccgtgttgcgggatgcggaccggaaaagcatcctg
gaactcgcccaggagatcaccgagctctcggccaaggcccgggaggggcggctttcccct
gaggaggtgacgggctccaccttcaccattaccaacatcggctccgtgggggccaccctg
agcttccccatcatcaaccttcccgaggccgccatcctgggggtgcactccatccgcaag
cgcccctgggtcatgcccgatggctccatccaggcccgggacatcatgtacctctccctt
tcctttgaccaccgcctggtggacggggccgaggcggccaggttcacccgggaggtgatc
cggcttttggagaaccccgaggttctcctcctggaaatgtag

DBGET integrated database retrieval system