KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20680Help
Entry
TCCBUS3UF1_20680  CDS       T01866                                 

Definition
(GenBank) Peptidase M42
Organism
thc  Thermus sp. CCB_US3_UF1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2063803..2064834
Genome map
AA seq 343 aa AA seqDB search
MDYAPHLPFLERLLMAAGPSGFEGEATRVFLEEAKTFALTEEDRHGNAYARLNPGGRPKV
LLLGHADEIGVIVSHVEEGGFLRLKPLGGWDPQVLVGQRLRFLGKGGPVYGVVGRKAVHV
LKEEERKRAVALEDLFADIGARDREEALAHLEVGSVGVLDQPPRWLLGRRLASKALDNRL
GAFVVLEALRLLQGRTGAEVVAVATVQEEIGAYGARTAAFREAPDLALVVDVHHDGTTPG
MEKARVGEAALGQGVVLDVGPFADREVLKGLRAVAEEAGIPYVLHAHGPSSGTDADEVAK
VREGIPTGILSLPLRYMHSPVEVVDLADVERAVRLLALYVARL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggactacgcgccccacctgcctttcctggaaaggctcctcatggccgcgggcccctcg
gggtttgagggggaggccacccgggtcttcctggaggaggccaagaccttcgcccttacc
gaagaggaccggcacggcaacgcctacgcccggctgaaccccggaggcaggcccaaggtc
ctcctcctggggcacgcggacgagatcggggtcatcgtgagccacgtggaggaaggaggc
ttcctgcgcctcaagcccctggggggctgggacccgcaggtcctggtggggcagcgcctc
cgcttcctgggcaagggggggccggtttacggggtggtgggccggaaggcggtccacgtg
ctcaaggaggaggagcgcaaacgggccgtggccctggaggacctcttcgccgacatcggg
gccagggaccgcgaggaggccctggcccacctcgaggtgggctcggtgggcgtcctggac
cagccgccccgctggctcctggggaggaggctcgcctccaaggccctggacaaccgcctg
ggggccttcgtggtcctggaggccctccgcctcctccaggggcgcacgggggctgaggtg
gtggcggtggccacggtgcaggaggagatcggagcctacggggccaggaccgcggccttc
cgcgaggccccggacctggccctggtggtggacgtccaccacgacggcaccacccccggg
atggagaaggcccgggtgggggaggcggccctgggccaaggggtggtgctggacgtgggg
cccttcgccgaccgggaggtcctgaagggccttagggccgtggccgaggaggcgggcatc
ccctatgtcctccacgcccacgggccctcttccggcaccgacgccgacgaggtggccaag
gtgcgggaggggatccccacgggcatcctctccctccccttgcgctacatgcactccccg
gtggaggtggtggacctggccgacgtggagcgggccgtccgccttctggccctctacgtg
gcccgcctctag

DBGET integrated database retrieval system