KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_20680Help
Entry
TCCBUS3UF1_20680  CDS       T01866                                 

Definition
Peptidase M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TCCBUS3UF1_20680
Enzymes [BR:thc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TCCBUS3UF1_20680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2063803..2064834
Genome map
AA seq 343 aa AA seqDB search
MDYAPHLPFLERLLMAAGPSGFEGEATRVFLEEAKTFALTEEDRHGNAYARLNPGGRPKV
LLLGHADEIGVIVSHVEEGGFLRLKPLGGWDPQVLVGQRLRFLGKGGPVYGVVGRKAVHV
LKEEERKRAVALEDLFADIGARDREEALAHLEVGSVGVLDQPPRWLLGRRLASKALDNRL
GAFVVLEALRLLQGRTGAEVVAVATVQEEIGAYGARTAAFREAPDLALVVDVHHDGTTPG
MEKARVGEAALGQGVVLDVGPFADREVLKGLRAVAEEAGIPYVLHAHGPSSGTDADEVAK
VREGIPTGILSLPLRYMHSPVEVVDLADVERAVRLLALYVARL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggactacgcgccccacctgcctttcctggaaaggctcctcatggccgcgggcccctcg
gggtttgagggggaggccacccgggtcttcctggaggaggccaagaccttcgcccttacc
gaagaggaccggcacggcaacgcctacgcccggctgaaccccggaggcaggcccaaggtc
ctcctcctggggcacgcggacgagatcggggtcatcgtgagccacgtggaggaaggaggc
ttcctgcgcctcaagcccctggggggctgggacccgcaggtcctggtggggcagcgcctc
cgcttcctgggcaagggggggccggtttacggggtggtgggccggaaggcggtccacgtg
ctcaaggaggaggagcgcaaacgggccgtggccctggaggacctcttcgccgacatcggg
gccagggaccgcgaggaggccctggcccacctcgaggtgggctcggtgggcgtcctggac
cagccgccccgctggctcctggggaggaggctcgcctccaaggccctggacaaccgcctg
ggggccttcgtggtcctggaggccctccgcctcctccaggggcgcacgggggctgaggtg
gtggcggtggccacggtgcaggaggagatcggagcctacggggccaggaccgcggccttc
cgcgaggccccggacctggccctggtggtggacgtccaccacgacggcaccacccccggg
atggagaaggcccgggtgggggaggcggccctgggccaaggggtggtgctggacgtgggg
cccttcgccgaccgggaggtcctgaagggccttagggccgtggccgaggaggcgggcatc
ccctatgtcctccacgcccacgggccctcttccggcaccgacgccgacgaggtggccaag
gtgcgggaggggatccccacgggcatcctctccctccccttgcgctacatgcactccccg
gtggaggtggtggacctggccgacgtggagcgggccgtccgccttctggccctctacgtg
gcccgcctctag

DBGET integrated database retrieval system