KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_21520Help
Entry
TCCBUS3UF1_21520  CDS       T01866                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCCBUS3UF1_21520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_21520
   00052 Galactose metabolism
    TCCBUS3UF1_21520
   00500 Starch and sucrose metabolism
    TCCBUS3UF1_21520
   00520 Amino sugar and nucleotide sugar metabolism
    TCCBUS3UF1_21520
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TCCBUS3UF1_21520
   00524 Butirosin and neomycin biosynthesis
    TCCBUS3UF1_21520
Enzymes [BR:thc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TCCBUS3UF1_21520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2133567..2134475
Genome map
AA seq 302 aa AA seqDB search
MRVVGLDLGGTKIAAGVFDGEGLRSRVVLPTPKEGGEKVVAALAEAALQAEAQAGAKAQA
IGLGTPGPLDFQRGIIRFTPNIPGLQDFPIRRLLEEATGRPVYLENDANAAALAEHHLGA
ARGEESSLFLTVSTGIGGGVVLKGRVLRGERGQGGELGHTTLLPGGPVCGCGLEGCLEAL
AAGRALEREASYAYGRPVDTKELFRLFGAGEAKARRLVLQAARYVGIGLASLVKAFDPSV
VVVGGGLALNAPMGYWQALEEAYRHYLAGWEVPPLRRALLGSEAGLLGAALTAYLEVQGG
GG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagggtggtgggcctggacctgggaggcaccaagatcgccgccggggtgtttgacggg
gagggcctgcgttcccgggtggtcctccccacccccaaggaagggggggagaaggtggtg
gccgccctggccgaggccgccctccaagcggaggcccaggccggggcaaaggcccaggcc
atcggcctcggtacccccggccccttggatttccagcgggggatcatccgcttcaccccc
aacatccctggcctgcaggacttccccatccgccgcctcctggaggaggccacgggccgg
cccgtctacctggaaaacgacgccaacgccgccgccttggccgagcaccacctgggggcc
gcacggggggaggagagttcccttttcctcacggtctccaccgggatcgggggtggggtg
gtccttaagggcagggtgctccggggggagcggggccagggcggggagctggggcacacc
accctcctccccggggggccggtgtgcggctgcggcctggaggggtgcctcgaggccctg
gccgccggcagggccctggaacgggaggccagctacgcctacgggcgccccgtggacacc
aaggagctcttccgcctcttcggggcgggggaggccaaggccaggcgtctggtgctccag
gcggcccggtacgtgggcatcggcctggctagcctggtcaaggcctttgaccccagcgtg
gtggtggtgggcgggggcctggccctgaacgcccccatggggtactggcaggccctggaa
gaggcctaccgccactacctggccggctgggaggtcccccccctgcgccgggcccttctg
gggagcgaggctgggcttctgggggcagccctcaccgcctacctggaggtgcaaggtggc
ggcgggtaa

DBGET integrated database retrieval system