KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_21610Help
Entry
TCCBUS3UF1_21610  CDS       T01866                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:thc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2144623..2145231)
Genome map
AA seq 202 aa AA seqDB search
MSRKMVEIEETGLSFATEVDLERLQHLSAEWLAVIGEDPAREGLRKTPERVAKAWAFLTR
GYRQDLKEIVNGAVFQAEGSEMVVVKGVEFYSLCEHHLLPFFGQVHIGYIPNGKILGLSK
FARIVDMFARRLQVQERLAVQVAEAIQEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTIT
SAMLGVFRESQKTREEFLSHLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaagatggtggagatcgaagaaactggtctgagcttcgcaaccgaggtggac
ctggagcgcctccagcacctttccgccgagtggttggccgtcatcggcgaggaccccgcc
cgggagggcctccggaaaacccccgaacgggtggccaaggcctgggccttcctcacccgg
ggctaccgccaggacctgaaggagatcgtgaacggggcggtcttccaggccgaggggagc
gagatggtggtggtgaagggcgtggagttctactccttgtgcgagcaccacctcctcccc
ttcttcggccaggtgcacatcggctacatccccaacggcaagatcctgggcctttccaag
ttcgcccgcatcgtggacatgtttgcccgcaggctccaggtgcaggagcgcctggcggtc
caggtggccgaggccatccaggaggtcctggaaccccaaggggtgggggtggtggtggaa
ggggtccacctgtgcatgatgatgcggggggtggagaagcagcactcccggaccatcacc
agcgccatgctgggggtcttccgcgaaagccagaagacccgggaagagttcttaagccac
ctcaagtaa

DBGET integrated database retrieval system