KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_21610Help
Entry
TCCBUS3UF1_21610  CDS       T01866                                 

Definition
(GenBank) GTP cyclohydrolase 1
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00790  Folate biosynthesis
thc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCCBUS3UF1_21610
Enzymes [BR:thc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TCCBUS3UF1_21610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEV17197
UniProt: G8NC50
Position
complement(2144623..2145231)
Genome map
AA seq 202 aa AA seqDB search
MSRKMVEIEETGLSFATEVDLERLQHLSAEWLAVIGEDPAREGLRKTPERVAKAWAFLTR
GYRQDLKEIVNGAVFQAEGSEMVVVKGVEFYSLCEHHLLPFFGQVHIGYIPNGKILGLSK
FARIVDMFARRLQVQERLAVQVAEAIQEVLEPQGVGVVVEGVHLCMMMRGVEKQHSRTIT
SAMLGVFRESQKTREEFLSHLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaagatggtggagatcgaagaaactggtctgagcttcgcaaccgaggtggac
ctggagcgcctccagcacctttccgccgagtggttggccgtcatcggcgaggaccccgcc
cgggagggcctccggaaaacccccgaacgggtggccaaggcctgggccttcctcacccgg
ggctaccgccaggacctgaaggagatcgtgaacggggcggtcttccaggccgaggggagc
gagatggtggtggtgaagggcgtggagttctactccttgtgcgagcaccacctcctcccc
ttcttcggccaggtgcacatcggctacatccccaacggcaagatcctgggcctttccaag
ttcgcccgcatcgtggacatgtttgcccgcaggctccaggtgcaggagcgcctggcggtc
caggtggccgaggccatccaggaggtcctggaaccccaaggggtgggggtggtggtggaa
ggggtccacctgtgcatgatgatgcggggggtggagaagcagcactcccggaccatcacc
agcgccatgctgggggtcttccgcgaaagccagaagacccgggaagagttcttaagccac
ctcaagtaa

DBGET integrated database retrieval system