KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_22500Help
Entry
TCCBUS3UF1_22500  CDS       T01866                                 

Definition
(GenBank) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00010  Glycolysis / Gluconeogenesis
thc00030  Pentose phosphate pathway
thc00051  Fructose and mannose metabolism
thc00052  Galactose metabolism
thc00680  Methane metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
thc01230  Biosynthesis of amino acids
thc03018  RNA degradation
Module
thc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCCBUS3UF1_22500
   00030 Pentose phosphate pathway
    TCCBUS3UF1_22500
   00051 Fructose and mannose metabolism
    TCCBUS3UF1_22500
   00052 Galactose metabolism
    TCCBUS3UF1_22500
  Energy metabolism
   00680 Methane metabolism
    TCCBUS3UF1_22500
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TCCBUS3UF1_22500
Enzymes [BR:thc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TCCBUS3UF1_22500
Protein phosphatases and associated proteins [BR:thc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TCCBUS3UF1_22500
Messenger RNA biogenesis [BR:thc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TCCBUS3UF1_22500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat PucR Peripla_BP_6 AP_endonuc_2 LpxK
Motif
Other DBs
NCBI-ProteinID: AEV17286
UniProt: G8NCV0
Position
complement(2233205..2234173)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAYALGLEVMGIRRGYAGMIHGEMLPLGVRDVANI
LQRGGTILLTARSQEFLTEEGRAKAAERLRAAGIEGLVAIGGDGTFRGAMRLAEEHRIPV
VGVPGTIDNDLFGTDYTIGFDTAVNTALEAIDRIRDTAASHERVFLIEVMGRDSGFIALD
VGLAGGAEVIALPEEPVDPKAIAEGLLESQRRGKTSSIVVVAEGAYPGGAAGLLAAIREH
VRVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALAAGASGVMVGEVEGEVEFTPLK
EAVERRKDIRRSLLGLSRVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcataggggttttcaccagcggcggcgacgcgccgggcatgaacgccgccatc
cgggcggtggtgcgccaggcctacgccttgggcctcgaggtcatgggcatccgccggggc
tacgccggcatgatccacggggagatgcttcccttgggggtgcgggacgtggccaacatc
ctgcagcgggggggcaccatcctcctcaccgccaggagccaggagtttttgacggaggag
gggcgggccaaggcggcggagaggctgagggcggcggggattgagggcctggtggccatc
gggggcgacggcaccttccgcggggccatgcgcctggccgaggagcaccggattcccgtg
gtgggggtgccgggcaccattgacaacgaccttttcggcaccgactacaccatcggcttt
gacaccgcggtgaacacggccctggaggccattgaccgcatccgcgacaccgccgcaagc
cacgagcgggtcttcctcattgaggtcatggggcgggactcgggcttcatcgccctggac
gtgggcctggcgggaggggccgaggtgatcgccctccctgaggagcccgtggaccccaag
gccatcgccgaggggctcctggagtcccagcgccggggcaagaccagctccatcgtggtg
gtggcggaaggggcttaccccgggggggcggcggggcttttggccgctatccgggagcac
gtgcgggtggaggcccgggtcacggtcctgggccacatccagcgggggggaagccccacg
gccaaggaccggatcctggccagccgcctgggggcggcggcggtggaggccctggccgcg
ggggcgagcggggtcatggtgggggaggtggagggggaggtggagttcacccccctgaag
gaggcggtggagcgccgcaaggacatccgccgctcccttttgggcctatcgcgggttctg
gccctctag

DBGET integrated database retrieval system