KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_2900Help
Entry
TCCBUS3UF1_2900   CDS       T01866                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TCCBUS3UF1_2900
Enzymes [BR:thc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TCCBUS3UF1_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320079..320897
Genome map
AA seq 272 aa AA seqDB search
MLWLRDRALDLSRPRLMGILNLTPDSFSDGGLYLDPERALARARAMVAEGADLLDLGAES
TRPGAEPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALRMGAHLLNDVTGLRD
ERMLALAARFGVAAVVMHMPVPDPKAMMAHARYGDVVAEVRAFLKAQAERALRAGVPQVV
LDPGFGFGKLLEHNLALLRRLEAIVELGHPVLVGLSRKRTIGELTGVEAPGERVLGSVAA
HLYAVLKGARILRVHDVGAHREALAVWNALWG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgctctggctacgcgaccgcgccctggacctttcccgcccccggctcatgggcatcctc
aacctcacccccgactccttctccgacggggggttgtacctggacccggaaagggccctg
gcgcgggcccgggccatggtggccgaaggggccgacctcctggacctgggggccgagtcc
acccgccccggggcggagccggtgccggtggaggaggaaaagcgccggcttctgcccgta
ctggaggcggtgctctccttgggggtgcccgtgagcgtggacacccgtaagcccgaggtg
gccgaggaggccctcaggatgggggcccacctcctgaacgacgtgacgggcttacgggat
gagcgcatgctggccctggcggcccgcttcggcgtggccgcggtggtcatgcacatgccc
gtgcccgatcccaaggccatgatggcccatgcccgctacggcgacgtggtggctgaggtc
cgggccttcctaaaggcccaggcggaaagggccctccgggccggggtgccccaggtggtc
ctggacccggggtttggcttcggcaagctcctggagcacaacctggccctcctgcgccgc
ctggaggccatcgtggagctaggccacccggtcctggtggggctttcccgcaagcgcacc
atcggggagctcacgggggtggaggcgccaggggagcgggtcctgggctccgtggccgcc
cacctctacgcggtcctcaaaggggccaggatcctccgggtgcacgacgtgggggcccac
cgggaggcccttgcggtgtggaacgccctctgggggtag

DBGET integrated database retrieval system