KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_3180Help
Entry
TCCBUS3UF1_3180   CDS       T01866                                 

Definition
Carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Brite
Enzymes [BR:thc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     TCCBUS3UF1_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(343118..343810)
Genome map
AA seq 230 aa AA seqDB search
MNLLLLHGFTSHPLLTLGPLPQALREAGFSVRQPTLPGHGTRPEDLLQVRWRDWLETARA
AYRDLPEPRGVVGLSMGALLAAHLAAETPTALLVALAPALALKSPLAPLAPVLAPLIPRF
PGPDSICDPECQRQNPNYPYFPTRAVLQLLALMGQTPRVLPRVEAPALVVEAGKDKVVKG
VRRYHRLLGSARKDYLVFPESGHDLLLDRDREAVARAVQDWIIATSNHSQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctgctcctcctgcacggttttacctcccaccccctcctcaccctgggacccctg
ccccaggccttgcgggaagcggggttttccgtgcgtcagcccaccctacccggccacggg
acgaggcccgaggacctgctccaggtgcgctggcgggactggctggaaaccgcccgggcc
gcctaccgggacctccccgagccccggggcgtggtggggctctccatgggagccctcctg
gccgcccacctggccgcggaaacccccaccgccctcctggtggccctggcccccgccctg
gccctgaaaagccccctggccccgctggcccccgtccttgcccccctcatcccccgcttc
cccggtcccgattccatctgcgatccggagtgccaaaggcaaaaccccaactacccctac
ttccccacccgggcggttttgcagctcctggccctcatgggccagacccccagggtcctc
cctcgggtagaggccccggccttggtggtggaagcgggcaaggacaaggtggtcaagggc
gtgcgccggtaccaccggcttctgggaagcgcccggaaggactacctggtcttcccggaa
agcggccatgacctcctcctggaccgggaccgggaggcggtggcccgggcggtgcaggac
tggattattgcaactagtaatcactcgcagtaa

DBGET integrated database retrieval system