KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_5140Help
Entry
TCCBUS3UF1_5140   CDS       T01866                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TCCBUS3UF1_5140
Enzymes [BR:thc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TCCBUS3UF1_5140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
516062..516724
Genome map
AA seq 220 aa AA seqDB search
MRGRLFVMTGASGVGKGTVRARVLERTRLFYSISMTTRPPRPGERDGVDYYFVDRPAFEA
LLAQDGFLEHAEYVGHLYGTPKAPVERALARGEDVLLEIEVQGALQVRAKVPEAVLIFLL
PPSLSELKRRLVYRGKDSPEKIQKRLAQAEWEIQNAHLFDYVVVNDVLEEAVADFLAILT
AERRRTPRMARALERALKRDGDLEAELDEILRRNHGGTRD
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcggggccgcctcttcgtcatgaccggggccagcggggtggggaagggcacggtgcgg
gcccgcgtgctggagcgtacccgcctcttttactccatctccatgaccacccggccccct
aggccgggggagcgggacggggtggactactacttcgtggaccgccccgccttcgaggcc
cttctggcccaggatgggttcctggagcacgccgagtacgtgggccacctctacggcacc
cccaaggccccggtggagcgggccctggcccggggggaggatgtgctcttggaaattgag
gtccaaggggccctccaggtgcgggccaaggtgccggaggcggttctcatcttccttctg
ccgccttccctttccgagctgaagcgccgcctggtctaccggggcaaggatagcccagaa
aagatccaaaaacgtttggcgcaggcggagtgggagatccagaacgcccacctctttgac
tacgtggtggtgaacgacgtgctggaggaggcggtggccgactttctggccatcctgacc
gcagagcggcggcggactcccaggatggcccgggccctggaacgggccctaaagcgggat
ggggatctggaagcggagctggacgagatcttgcggaggaaccatggcggaacccgggat
tga

DBGET integrated database retrieval system