KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_5340Help
Entry
TCCBUS3UF1_5340   CDS       T01866                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:thc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
533095..533772
Genome map
AA seq 225 aa AA seqDB search
MLLTRGKDKALLEKLAALGVEAAEVALLEQVDLPGLARLPGLLREGVDWVAVTSKEGAGR
LLWAWEEAGRPPLKVAAVGEGTAGVLAAGGLPPAFLPPRATAQDLALAFPPAQRVLFVAG
DLAGGDLEEGLRVRGVRVERLTVYATRARALGEEEVALLARAQVAAFFSPSGVRAFARWT
ERRPKAACIGPVTAREAGALGFPVVEAENPGLEGLLRAILQALGT
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtgctcctcacccgggggaaagataaggcgcttttggaaaagcttgccgccttgggggtg
gaggcggcggaggtggcccttttggaacaggtggaccttcccgggctggcccgccttcct
gggctgctccgggagggggtggactgggtggcggtgacctccaaggagggggcggggcgc
ctcctttgggcctgggaagaggcgggaaggccccccttgaaggtggccgcggtgggggag
gggacggctggggtcctggcggcgggggggcttcccccggccttccttcccccccgggcc
acggcccaggacctggccttggcctttccccccgcccaaagggtcctcttcgtggccggg
gacctggcggggggggacctggaggaggggcttagggtccggggggtgagggtggagcgc
cttacggtctacgccacccgggcgcgggccctaggggaagaggaggtggccctcctggcg
agggcccaggtggcggcctttttcagccccagtggggtccgggccttcgcccgctggacg
gaaaggaggcccaaggcggcctgcatcggccctgtcaccgcacgggaggcaggggccttg
ggctttcccgtggtggaggcggaaaaccctggcctggagggtcttttgcgggccattctc
caggccttggggacataa

DBGET integrated database retrieval system