KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_5710Help
Entry
TCCBUS3UF1_5710   CDS       T01866                                 

Definition
hypothetical protein
Orthology
K06187  
recombination protein RecR
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:thc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(561831..562415)
Genome map
AA seq 194 aa AA seqDB search
MRYPERLLKLARALSRLPGIGPKTAQKLSLHLAFHREEAGELREALAGLEALGLCRVCGN
LAEGELCPICQDEGRDRGLLAVVESVADLFALERSGEFPGVYHVLGGALNPLEGVGPREL
NLESLWPRLAGVREVVLATSMTVEGEATALYLAEELKRRGVKATRLAYGLPVGGSLEYVD
EVTLGRALEGRKPI
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcgctaccctgagcgcctcctcaagctggcccgggccctctcccgcctgccagggatc
ggccccaagacggcgcagaagctctccttgcacctggccttccaccgggaggaggcgggg
gagctaagggaggccttggcgggcctggaagccttgggcctctgccgggtctgcggcaac
ctggccgagggggagctttgccccatctgccaggacgagggccgggaccgcggcctcttg
gcggtggtggagagcgtggccgacctcttcgccctggagcggagcggggagttccccggg
gtctaccatgtcctggggggggccctgaaccccctggagggggtggggccccgggaactc
aacctggaaagcctctggccgaggctggccggggtgagggaggtggtgctggccacctcc
atgaccgtggaaggcgaggccaccgccttgtacctggcggaggagctgaagcgccggggg
gtgaaggccacccggctggcctacggccttcccgtggggggaagcctggagtacgtggac
gaggtcaccctgggccgggccctggaggggcgcaaacccatctaa

DBGET integrated database retrieval system