KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_5720Help
Entry
TCCBUS3UF1_5720   CDS       T01866                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TCCBUS3UF1_5720
Enzymes [BR:thc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TCCBUS3UF1_5720
Exosome [BR:thc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TCCBUS3UF1_5720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
562486..563745
Genome map
AA seq 419 aa AA seqDB search
MGLLLGILDGHQKEVFQALQVVPEGLEDLGLQAHGQDLPVAVGLHLHQTLGGAHHGQGFQ
ALLDLRRLLLCFLGLLQELLQVHAPSPMSIVEAMERPRRLRSPLLRRLVAEVDLSPRHLI
LPLFVKEGGEPEEVASMPGVFRHPLSRLPQVGEAALEAGLGGVILFGVLPEEAKDPWGQG
AYAEEGVVQRAIRLLKEAFPELLVLADTCLCEYTDHGHCGVVRQGPLGFYVDNDATLDLL
AKTALSQAQAGADVVAPSAMMDGQVQAIRQALDQGGFPHVPILSYAVKYASAFYGPFREA
AASAPQFGDRSGYQMDPRAGLWDALREARLDDLEGADLLMVKPALPYLDVLHALRERFAK
PLFAYQVSGEYAMLKAAALRGWLEERRAVLESLYALRRAGAQGILTYYALEAARWLKEG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgggccttcttctgggcatcctggatggccaccaaaaggaggtcttccaggccctccag
gtcgtcccggaaggcctcgaggacctcgggcttcaggcgcacggccaggatcttcccgtg
gccgttggcctccacctccaccagaccctgggcggtgcccaccacggtcagggtttccag
gcgctcctggatctccgccgccttcttctgtgctttctgggcctccttcaagagcttctg
caggttcatgctccctcccccatgagtatagtggaagccatggagcgcccaagaaggctt
cgttcccccctcttgcgccgcctggtggccgaggtggacctctccccccgccacctcatc
ctccccctcttcgtcaaggaagggggggagccggaggaggtggcctccatgccgggggtc
ttccgccatcccctttcccgcctgccccaggtgggggaggcggccttggaagccggtctg
ggcggggtgatcctctttggcgtcctgcccgaggaggccaaggacccctggggccagggg
gcctacgcggaggagggggtggtccagcgggccatccgcctcctcaaggaggccttcccc
gagcttttggtcctggccgacacctgcctctgcgagtacacggaccacggccactgcggg
gtggtgcgccaggggcccctggggttttacgtggacaacgacgccaccttggacctcctg
gccaagaccgccctttcccaggcccaggcgggggcggacgtggtggcccccagcgccatg
atggacggccaggtgcaggccatccgccaggccctggaccaaggcggtttcccccacgtg
cccatcctgtcctacgcggtgaagtacgcctccgccttctacggccccttccgcgaggcg
gcggccagcgccccccagttcggggaccgttccggttaccagatggatccccgggcgggc
ctgtgggatgccctgcgggaggcccggctggatgacctcgagggggccgacctcctcatg
gtcaagcccgcccttccctacctggacgtgctccacgccctgagggagcgcttcgccaag
ccccttttcgcctaccaggtctcgggggagtacgccatgctcaaggcggcggccctaagg
ggctggctggaggaaaggcgggcggtgctggaaagcctttatgcccttaggcgggccggg
gcccaggggatcctcacctactacgccctggaagcagcccgctggctcaaggaaggctag

DBGET integrated database retrieval system