KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_7190Help
Entry
TCCBUS3UF1_7190   CDS       T01866                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TCCBUS3UF1_7190
Enzymes [BR:thc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TCCBUS3UF1_7190
Exosome [BR:thc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TCCBUS3UF1_7190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703654..705138
Genome map
AA seq 494 aa AA seqDB search
MTYLLALDQGTTSSRAILFTPEGRPVALAQRGFTQHYPRPGWVEHDPLELWESQLWAAQE
ALRRAGVGAGEVAALGIANQRETTLVWERGTGRPLHPAIVWQDRRTAPLCQALRERGLEG
VFRERTGLLLDPYFSATKLLWLLENVPGLKEKGERGEALFGTVDTWLLYRLTGGQVHATD
PTNASRTLLFNLHTGSWDEELLGLLGIPRAMLPEVRPSDGAFGETLPELLGAPIPIRGVL
GDQQAALLGQGGLEAGAAKCTYGTGAFLLLHTGERPVLPPQGLLATPAYAPRGGRAYALE
GSVFVAGAAVGWLEEVGLLGKGEAEALAGQVEDAGGVYFVPAFTGLGAPYWDPYARGGIL
GLTRGTTRAHLVRAALEGVAFSVGEVVRAMAEAAGLALGALKADGGMAGNDLFLQIQADL
LGVPVLRPGVTETTALGAAWAAGVGVGLLAPEDLKGLWREAARFSPRMPEAKREARYRGW
RRAVDRVRGWAEEG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacctacctgttggccctggaccaaggcaccacttccagccgggccatcctctttacc
ccggaggggcggcccgtggccctggcccagcggggcttcacccagcactaccccaggccg
ggctgggtggagcacgaccccttggagctctgggagagccagctttgggcggcccaggag
gccctgcggcgggcgggggtgggggcgggggaggtggcggccctggggattgccaaccag
cgggagaccaccctggtctgggagcgggggacgggaaggcccctccacccggccatcgtc
tggcaggaccgccgcaccgcccccctgtgccaggctctgagggagcggggcctggagggg
gttttccgggagcgcacgggccttctcctggacccctacttctccgccaccaagctcctt
tggcttctggaaaacgtgccgggcctcaaggagaagggggagaggggggaggcccttttc
ggcaccgtggacacctggctcctctatcgcctcaccgggggccaggtccacgccaccgac
cccaccaacgccagccgcaccctgcttttcaacctccataccgggtcctgggacgaggag
cttttggggctcctgggcatcccccgggccatgctccccgaggtccgcccctcggatggg
gcctttggggagaccctgcccgaactcctgggggcccccatccccatccggggggtgttg
ggggaccagcaggcggccctcctgggccaggggggcctggaggcgggggcggccaagtgc
acctacggcacgggggccttcctcctcctgcacacgggggagcggcccgtgcttcccccc
cagggcctcctggccacccccgcctacgccccccggggcggacgggcctacgccctggag
gggagcgtcttcgtggccggggcggcggtgggctggctggaggaggtgggcctcctgggg
aaaggggaggcggaggccctggcggggcaggtggaggatgcgggcggggtgtacttcgtc
cccgcctttaccgggcttggggccccctactgggacccctacgcccgggggggcatcctg
ggccttacccgggggaccaccagggcccacctggtgcgggcggccctggagggggtggcc
ttttccgtgggggaggtggtgcgggccatggcggaggcggcgggcctggcccttggggcc
ctgaaggcggatggggggatggcggggaacgaccttttcctgcagatccaggccgacctc
ctgggggtgccggtcctgaggccgggggtgacggagaccaccgccttgggggcggcctgg
gccgcgggggtgggggtgggcctcctggccccggaggacctgaagggactgtggcgggag
gcggcccgcttctccccccggatgcccgaggccaagcgggaggcccgctaccggggctgg
cggcgggccgtggaccgggtgcggggctgggccgaggaggggtag

DBGET integrated database retrieval system