KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_7400Help
Entry
TCCBUS3UF1_7400   CDS       T01866                                 

Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCCBUS3UF1_7400
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TCCBUS3UF1_7400
Enzymes [BR:thc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TCCBUS3UF1_7400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
725301..726269
Genome map
AA seq 322 aa AA seqDB search
MFHPYKYSPQRAFFLGVRHKLPGRCMGLSATMPPMDRVAVIGVPMDLGSGRRGVDMGPSA
LRYARLLEELEALGYGVEDLGDVRVPLAETLRARKGPYLEEIRQAALELQERLRALPRGV
FPIVLGGDHSLSMGSVSGVARGRLGVVWVDAHADFNTPETSPSGNIHGMPLAVLSGLGHP
RLVEAFRSVDPKDVALIGVRSIDPGERRLLGEAGVLVYTMHEVDRLGIARIAEEVLERLS
GLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILAQSGRVQSLDLVEVNPILD
ERNRTAEMMVGLALSLLGKRIL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgttccatccttacaagtatagcccgcaaagggcctttttcctaggggtaaggcataaa
cttcccgggcggtgcatgggcctttctgctaccatgccccccatggaccgggtagcggtg
atcggcgtgcccatggacctggggtctgggcggcgcggggtggacatggggccctcggcc
ttgcgctacgcccggcttctggaggagctggaggccctggggtatggggtggaggacctg
ggggatgtgcgcgtccccctggcggaaaccctaagggcccgcaaggggccctacctggag
gagatccgccaggcggccttagagctccaggagcggcttagggcccttccccgaggggtc
ttccccatcgtcttagggggagaccattccctcagcatgggctcggtctccggggtggcc
cgggggcggctgggggtggtctgggtggatgcccacgccgacttcaacaccccggaaacc
agcccctccggcaacatccacggcatgcccctggcggtgctttccggcctgggccacccg
aggctggtggaggccttccggtcggtggaccccaaggacgtggccctcatcggggtgcgg
agcatagatcccggggaaaggcggcttctaggggaggccggggttttggtctacaccatg
cacgaggtggaccgcctggggatagcccggatcgccgaggaggtgctggaaaggctttct
ggcctgcccctgcacgtttccctggatgccgatgtcctggaccccaccctggccccgggg
gtggggaccccggtgccgggggggcttacctaccgggaggcccatctcctcatggagatc
ctggcccagtcgggacgggtgcaaagcctggacctggtggaggtgaaccccatcctggac
gagaggaaccgcacggcggagatgatggtgggcctggccttaagcctcctggggaagcgg
atcctgtag

DBGET integrated database retrieval system