KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_7400Help
Entry
TCCBUS3UF1_7400   CDS       T01866                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00220  Arginine biosynthesis
thc00330  Arginine and proline metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01130  Biosynthesis of antibiotics
thc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TCCBUS3UF1_7400
   00330 Arginine and proline metabolism
    TCCBUS3UF1_7400
Enzymes [BR:thc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TCCBUS3UF1_7400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEV15788
UniProt: G8NB98
Position
725301..726269
Genome map
AA seq 322 aa AA seqDB search
MFHPYKYSPQRAFFLGVRHKLPGRCMGLSATMPPMDRVAVIGVPMDLGSGRRGVDMGPSA
LRYARLLEELEALGYGVEDLGDVRVPLAETLRARKGPYLEEIRQAALELQERLRALPRGV
FPIVLGGDHSLSMGSVSGVARGRLGVVWVDAHADFNTPETSPSGNIHGMPLAVLSGLGHP
RLVEAFRSVDPKDVALIGVRSIDPGERRLLGEAGVLVYTMHEVDRLGIARIAEEVLERLS
GLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILAQSGRVQSLDLVEVNPILD
ERNRTAEMMVGLALSLLGKRIL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgttccatccttacaagtatagcccgcaaagggcctttttcctaggggtaaggcataaa
cttcccgggcggtgcatgggcctttctgctaccatgccccccatggaccgggtagcggtg
atcggcgtgcccatggacctggggtctgggcggcgcggggtggacatggggccctcggcc
ttgcgctacgcccggcttctggaggagctggaggccctggggtatggggtggaggacctg
ggggatgtgcgcgtccccctggcggaaaccctaagggcccgcaaggggccctacctggag
gagatccgccaggcggccttagagctccaggagcggcttagggcccttccccgaggggtc
ttccccatcgtcttagggggagaccattccctcagcatgggctcggtctccggggtggcc
cgggggcggctgggggtggtctgggtggatgcccacgccgacttcaacaccccggaaacc
agcccctccggcaacatccacggcatgcccctggcggtgctttccggcctgggccacccg
aggctggtggaggccttccggtcggtggaccccaaggacgtggccctcatcggggtgcgg
agcatagatcccggggaaaggcggcttctaggggaggccggggttttggtctacaccatg
cacgaggtggaccgcctggggatagcccggatcgccgaggaggtgctggaaaggctttct
ggcctgcccctgcacgtttccctggatgccgatgtcctggaccccaccctggccccgggg
gtggggaccccggtgccgggggggcttacctaccgggaggcccatctcctcatggagatc
ctggcccagtcgggacgggtgcaaagcctggacctggtggaggtgaaccccatcctggac
gagaggaaccgcacggcggagatgatggtgggcctggccttaagcctcctggggaagcgg
atcctgtag

DBGET integrated database retrieval system