KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_8390Help
Entry
TCCBUS3UF1_8390   CDS       T01866                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:thc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:thc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:thc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:thc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822054..824000
Genome map
AA seq 648 aa AA seqDB search
MDRIEGVLKEERVFYPSEAFRRQAHIASEEEYRRLYEESLQDPEGFWGRVASELHWFTPW
QKVLEGDLPHPKWFVGGTTNLSYNALDRHVQGWRKNKAALIWEGEPGEERVLTYHDLWRE
VQKFANVLKRLGVKKGDRVTIYLPMIPEAAIAMLACTRIGAVHSVVFGGFSSGALADRIK
DAEAKVLITADGGYRRGQIVPLKQNADEALRETSSVEHVVVVRRTGEEVPWTPGRDHWWH
ELMEAASDRSDPEPMEAEDPLFILYTSGSTGKPKGVLHTTGGYMTYVYYTTKMVFDLKDE
DVYWCTADVGWITGHSYVVYGPLLNGATTVMYEGAPNWPEPDRFWQIVDKYGVTILYTAP
TAIRAFMKWGEGWPLKHRLETLRLLGSVGEPINPEAWLWYYNVIGKGRCPIVDTWWQTET
GGIMITTLPGVHPMKPGHAGKPFFGVKPEILDSEHKPVENPDEGGHLCITRPWPSMLRTV
WGDPERFLQQYFSQHPGVYFTGDGARRDPQGYHMILGRVDDVLNVAGHRLGTMEIESALV
SHPAVAEAAVVGRPDPLKGEAIVAFVTLKEGHGPTEALRDELKAHVAKVIGPIARPDEVR
FTDALPKTRSGKIMRRLLRQIAAGEKEIKGDTSTLEDRSVVERLKEGA
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggaccggattgaaggggttttgaaggaggagcgggtgttctaccccagcgaggccttc
cgccggcaggcccacatcgccagcgaggaggagtaccggcgcctctacgaggaaagcctc
caggaccctgaaggcttctggggtagggtggcctcggagcttcactggtttaccccctgg
cagaaggtgctggagggggacctgccccaccccaagtggttcgtgggggggaccaccaac
ctctcctacaacgccctggaccgccacgtgcagggctggcgcaagaacaaggccgccctg
atttgggaaggggagccgggggaggagcgggtcctcacctaccacgacctctggcgggag
gtgcagaagttcgccaacgtcctgaagcgcctgggggtgaagaagggggatagggtcacc
atctacctccccatgatccccgaggcggccatcgccatgctggcctgcacccgcatcggg
gcggtgcactccgtggtcttcggcggtttctccagcggggccctggccgaccgcatcaag
gacgccgaggccaaggtcctcatcaccgccgacggcgggtaccgccgggggcagatcgtg
cccctgaagcagaacgcggacgaggccctgcgggagaccagcagcgtggagcacgtggtg
gtggtgcgccgcaccggggaggaggtgccctggaccccggggcgggaccactggtggcac
gagctcatggaggcagcctccgaccgctcggaccccgagcccatggaggccgaggacccc
cttttcatcctctacacctcggggtccacgggcaaacccaagggggtgctccacaccacg
ggcgggtacatgacctacgtctactacaccaccaagatggtctttgacctcaaggacgag
gacgtctactggtgcaccgccgacgtgggctggatcaccggccactcctatgtggtctac
gggcccctcctcaacggggccaccacggtgatgtacgagggggcccccaactggcccgag
cccgaccgcttctggcagatcgtggacaagtacggggtgaccatcctctacaccgccccc
acggccatccgggccttcatgaagtggggggagggctggcccctcaagcaccgcctggaa
accttaaggcttttgggcagcgtgggcgagcccatcaaccccgaggcctggctctggtac
tacaacgtgatcggcaagggccgctgccccatcgtggacacctggtggcagacggaaacc
ggggggatcatgatcaccaccctgcccggggtccaccccatgaagccagggcatgcgggc
aagcccttcttcggcgtgaagccggagattctggatagcgagcacaagccggtggaaaac
cccgacgagggggggcacctctgcatcacccggccctggcccagcatgctccgcaccgtc
tggggggatcctgaacgcttcttgcagcagtacttcagccagcaccccggggtgtacttc
accggggatggggcccgccgggacccccaggggtaccacatgatcctgggccgggtggac
gatgtcctgaacgtggcggggcaccggctgggcaccatggagatcgagtcggccctggtt
tcccaccccgcggtggccgaggccgcggtggtgggccgccccgaccccttgaagggggag
gccatcgtggccttcgtgaccctcaaggaggggcacggccccaccgaggccctccgagac
gagctcaaggcccacgtggccaaggtcatcgggcccatcgcccgccccgacgaggtgcgc
ttcacggacgccctgcccaagacccgttcggggaagatcatgcgccgcctcctgcggcag
atcgccgccggggagaaggagatcaagggggatacctctaccctggaagaccgctccgtg
gtggagcgcctgaaggaaggagcctaa

DBGET integrated database retrieval system