KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_9040Help
Entry
TCCBUS3UF1_9040   CDS       T01866                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TCCBUS3UF1_9040
Enzymes [BR:thc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TCCBUS3UF1_9040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
891232..892737
Genome map
AA seq 501 aa AA seqDB search
MELPRAYGLLLHPTSLPGPYGVGVLGEEARAFLRFLKESGARYWQVLPLGPTGYGDSPYQ
SFSAFAGNPYLIDLRPLAQAGYVALADPGFPQGRVDYGWLYAWKWPALKEAFRGFGAKAP
KEERESFLAFQEEEGSWLKDYALFMALKAHHGGLSWNRWPLPLRLREERALKEAEAALAE
EVAFHAWTQWLFFRQWGALKAEAEALGLEVIGDMPIFVAEDSAEVWAHPEWFHLDEEGRP
TVVAGVPPDYFSETGQRWGNPLYRWEVLEREGFSFWVARLAKALELFHLVRIDHFRGFEA
YWEIPATCPTAVEGRWVKAPGERLFERIQEVFGRVPILAEDLGVITPEVEALRDRFGLPG
MKVLQFAFDNGLENPFLPHNYPSHGRVVVYTGTHDNDTTLGWYRTATPHERAFLARYLAD
WGIGFQREEEVPWALMALGMRSLARLAVYPVQDVLALGSEARMNYPGRPAGNWAWRLRPG
ELSGEQGERLRQMAEATGRLS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggagctgccgcgcgcctatggcctcctcctccaccccaccagcctccctggcccgtac
ggggtgggggtgctgggggaagaagcccgggcctttttgcgctttctcaaggaatccggg
gcccggtactggcaggttctgcccttgggccccacgggctacggggactccccctaccag
tccttcagcgccttcgccgggaacccctacctcatcgacctgaggcccctggcccaggcg
gggtatgtggccttggccgatcccggcttcccccaggggcgggtggactacggctggctg
tacgcctggaagtggcccgccctgaaggaggccttccggggctttggggcaaaggccccc
aaggaggagcgggagagcttcctggccttccaggaggaggagggctcatggcttaaggac
tacgcccttttcatggccctaaaggcccaccacggggggctttcctggaaccggtggccc
ctgcccctgcgcctcagggaggaacgggccctcaaggaggccgaggcggccttggcggag
gaggtggcctttcacgcctggacccagtggcttttcttccgccaatggggggccttgaag
gccgaggccgaggccttgggcctcgaggtcatcggggacatgcccatcttcgtggctgag
gactccgccgaggtctgggcccaccccgagtggttccacctggacgaggagggccgcccc
acggtggtggccggggtgcccccggactacttttccgaaaccggccagcgctggggcaac
cccctttaccgctgggaggtgctggaacgggaaggcttctccttctgggtggcgcgtttg
gccaaggccctggagcttttccacctggtgcgcatcgaccacttccgcggctttgaggcc
tactgggagatccccgccacctgccccacggcggtggaagggcgctgggtcaaggccccg
ggggagcggctttttgagcgcatccaggaggtttttggccgggtgcccatcctggcggaa
gacctgggggtcatcaccccggaggtggaggccctgagggaccgcttcggccttcccggg
atgaaggtcctgcagttcgcctttgacaacggcctggaaaaccctttcctgccccataac
tacccttcccatggccgggtggtggtctacaccggcacccacgacaacgacaccaccctg
ggctggtaccgcaccgctaccccccacgagcgggcctttttggcccgctacctggcggac
tgggggattggcttccaaagggaggaggaggttccctgggccctcatggccctggggatg
cgctccctggcccggctggcggtgtacccggtgcaggacgtgctggccttgggctccgag
gcccggatgaactaccctggccgccctgcggggaactgggcctggcggctccgcccgggg
gagctatccggggaacagggggagaggcttcgccagatggccgaggccacgggacggctc
agctaa

DBGET integrated database retrieval system