KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_9060Help
Entry
TCCBUS3UF1_9060   CDS       T01866                                 

Definition
(GenBank) Succinyl-CoA ligase [ADP-forming] subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
thc00020  Citrate cycle (TCA cycle)
thc00640  Propanoate metabolism
thc00660  C5-Branched dibasic acid metabolism
thc01100  Metabolic pathways
thc01110  Biosynthesis of secondary metabolites
thc01120  Microbial metabolism in diverse environments
thc01130  Biosynthesis of antibiotics
thc01200  Carbon metabolism
Module
thc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
thc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TCCBUS3UF1_9060
   00640 Propanoate metabolism
    TCCBUS3UF1_9060
   00660 C5-Branched dibasic acid metabolism
    TCCBUS3UF1_9060
Enzymes [BR:thc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TCCBUS3UF1_9060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2 GARS_A Succ_CoA_lig eIF-6
Motif
Other DBs
NCBI-ProteinID: AEV15951
UniProt: G8NC61
Position
complement(893648..894820)
Genome map
AA seq 390 aa AA seqDB search
MPFGLGRPRRWSLNLHEYQAKEILARYGVPVPPGKVAYTPDEAKRIAEELGKRVVIKAQV
HVGGRGKAGGVKLADTPAEAYEKAQAILGMNIKGLTVKKVLVAEAVDIAKEYYAGLILDR
SQKKVVLMLSKEGGVDIEEVAAQRPEAIHKFWIDPHKGFRPFEAREMVKRAGLEGNLNKL
AQVLVALYRAYEGVDASIAEINPLVVTTDGQIVAADAKIVLDDNALFRHPDLAELREIEA
EHPLEVEASNYGFAYVKLPGSIGIIGNGAGLVMYTLDLVNRVGGKPANFLDIGGGAKADV
VYNALKVVLKDPDVKGVFLNIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEEA
KRLLEGKPIYMYPTSVEAAKAIVAMVGGAA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcggccttggccggccaaggaggtggagcttgaacctgcacgagtatcaagcc
aaggagatcctggcccgctacggggtgccggtgccgcccggcaaggtggcctacaccccc
gacgaggcgaagcggatcgccgaggaactgggcaagcgggtggtcatcaaggcccaggtg
cacgtgggcggcagaggcaaggcgggcggcgtaaagctggcggacacccccgccgaggcc
tacgagaaggcccaggccatcttgggcatgaacatcaagggcctcacggtgaagaaggtg
ctggtggccgaggcggtggacatcgccaaggagtactacgccggcctcatcctggaccgc
tcccagaagaaggtggtcctcatgctctccaaggaagggggggtggacattgaggaggtg
gccgcccaacgccccgaggccatccacaagttctggattgacccccacaagggcttccgc
ccctttgaggcccgggagatggtgaagcgggccgggctggaggggaacctgaacaagctg
gcccaggtcctggtggccctgtaccgggcctacgagggggtggacgcctccatcgccgag
atcaaccccctggtggtgaccacggacggccagatcgtggccgcggacgccaagatcgtc
ctggacgacaacgccctcttccgccaccccgacttggccgagcttcgggagatcgaggcc
gagcaccccttggaggtggaggccagcaactacggcttcgcctacgtgaagcttccgggg
agcatcggcatcatcggcaacggggccgggctcgtgatgtacaccctggacctggtgaac
cgggtggggggcaagcccgccaacttcctggacattgggggcggggccaaggccgatgtg
gtgtacaacgccctcaaggtggtcctcaaggacccggacgtcaagggggtcttcctcaac
atcttcggcggcatcacccgggccgacgaggtggccaagggggtgatccgggccctggag
gagggcctcctcaccaagcccgtggtcatgcgggtggcgggcactgccgaggaggaggcc
aagcggcttctggagggcaagcccatttacatgtaccccacgtccgtggaggcggctaag
gccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system