KEGG   Thermus sp. CCB_US3_UF1: TCCBUS3UF1_9750Help
Entry
TCCBUS3UF1_9750   CDS       T01866                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
thc  Thermus sp. CCB_US3_UF1
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:thc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCCBUS3UF1_9750
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TCCBUS3UF1_9750
Enzymes [BR:thc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TCCBUS3UF1_9750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
959731..960504
Genome map
AA seq 257 aa AA seqDB search
MRLRPCLDQVPGVLGEIARRRALEVAPYPLPEAPPRPPSFREALLAPGLSLIAEVKRQSP
SEGQIRSIDPAEAALAYARGGARAISVLTEPHRFGGSLEDLKRIWGAVDLPLLRKDFVVD
PFMLAEARAFGASAALLIVALLGELTAAYLEEAGRLGLEALVEVHTERELEVALEAGAQM
IGINNRDLATLRIDLATAPRLGRLARERGFAGVLVAESGYAQKEELRPLEGLFDAVLVGT
SLMRQPDLEAAVRELVG
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgcggccctgcctggaccaggttcccggggtcttgggggagatcgcccgtcgg
cgggccctcgaggtggccccttaccctttgcctgaagccccccctaggcccccctccttc
cgggaggccctcctggcccccgggctttccctcatcgccgaggtgaagcggcagagccct
tccgaggggcaaatccgctccatagaccccgcggaggccgccctggcctacgcccggggt
ggggcccgggccatcagcgtcctcaccgagccccaccgctttggcggcagcctggaagac
ctcaagcggatatggggggcggtggaccttcccctcctgcgcaaggacttcgtggtggac
cccttcatgctggccgaggcccgcgcctttggggccagcgccgccctcctcatcgtggcc
cttctgggggagctcaccgcggcctacctggaggaggccgggcggctgggcctcgaggcc
ctggtggaggtgcacacggaaagggagctggaggtggccctggaggcgggggcccagatg
atcgggatcaacaaccgcgacctcgccaccttgcgcatcgatcttgccaccgcgccccgt
ctgggccgcctggcccgagagcggggcttcgctggggtcttggtggcggagtccggctac
gcccaaaaggaagagctcaggcccttggaggggctttttgacgcggttctggtggggacc
agcctcatgcgccaacccgacctggaagccgccgttcgggagcttgtaggatag

DBGET integrated database retrieval system