KEGG   Thermococcus sp. 4557: GQS_01405Help
Entry
GQS_01405         CDS       T01588                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
the  Thermococcus sp. 4557
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GQS_01405
Enzymes [BR:the01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GQS_01405
Exosome [BR:the04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GQS_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294027..295523
Genome map
AA seq 498 aa AA seqDB search
MNYYLILDVGTTNVKAYAFSEEGEKLLEKSMRTRPVYPEPGWAELDPEELIETVRRLIDG
VTSSLGMPGGMAITNQRSSTVVWDDEGALHNMITWQDTRTRDIVEAFSRNFLVRFGRAIG
KVFYGLSRIVPGIASLPKGAYIITLAHVGFGTSHSSMHLRWLMDNVLEVRRALERGEAKF
GTMDSWIAWNLTGKHVTDYTNASATGLFDPFYLKWSDNIMGIVGIPKKILPALQPNDLPV
GETDYGVPLLTMVADQQAALYRAGVEPGSAKMTHGTGTFVDLNVGEKPKPASPGLYPMVA
LKTREKTLYLLEGIINASGSAVDWLLKVGLVEDYSEISGAFKDPALPRVLFIPAFAGLST
PYLRPDFRGALLNLSFSVRKEDIIKALIAGIAMRVAEVIAAMESGTRVEIGSLTSDGGAS
QIDPLLQLIADFSGKRIVRPVELNGSAQGTFMIARAVAEGRDVLSAWEKPMVERVFEPSG
EKHEDFRRLWEEFMGRLL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaattactacctcatcctcgacgttgggacgacgaacgttaaggcctacgctttttct
gaggagggggagaagctcctggagaagagcatgagaacgcggcccgtttatccagaacct
ggctgggccgaactcgaccccgaagagctcattgaaacggtcaggcggctcatagacggg
gttacttcttcccttgggatgccagggggaatggccatcaccaaccagcggagctccacc
gtcgtgtgggacgacgaaggagcgctccacaacatgataacctggcaggacacgaggacc
agagatatcgtggaggccttttcccgcaacttcctcgttcgctttggtagggctatcgga
aaggtcttctacggactctcccgcatcgttcccggaatagccagcctaccaaagggagcc
tatataatcaccctggcccatgtgggcttcggcacttcccactcctcgatgcacctacgc
tggctaatggacaacgtcctcgaggttcggagagccctggaacgcggtgaagcgaagttc
ggcacgatggacagctggatagcgtggaacctgacggggaagcacgtgacggactacacg
aacgcatccgcgacaggcctctttgacccattctacctcaagtggagcgacaacatcatg
ggcatcgtgggaattcccaagaaaatccttcccgccctccagccgaacgacctcccagtg
ggggaaacggactacggtgtgcccctcctcacgatggtggcggatcagcaggcggccctt
taccgtgcgggcgttgagccggggagcgcgaagatgacccacggaacagggaccttcgtc
gatctgaacgttggagagaaacccaaacccgcatcgcctggcctctacccaatggtcgcc
cttaaaacccgggaaaagacgctctacctccttgagggaataataaacgcctccggttcg
gccgttgactggctgctgaaagtggggctcgtcgaggactactccgagatcagcggtgcg
tttaaagaccccgcccttccaagggtgcttttcatacctgccttcgccggcctctcgacg
ccctatctgaggcctgacttcaggggagcgctcctcaacctgtcgttcagcgtaaggaag
gaagacatcatcaaggcgctcatagcggggatagcgatgagggtcgcggaggttatagcc
gccatggaatcgggaacccgggttgagattggctccctgacctccgacgggggtgcttcg
cagatcgacccgctcctgcagctgatagccgacttcagcgggaagagaatagtccgaccg
gtggagctcaacggctccgcgcagggaaccttcatgatagcacgggcggttgcggaggga
agggacgttctgagcgcgtgggagaaacctatggtggagagggtcttcgaaccgagcggg
gagaaacacgaggacttcagaaggctgtgggaggagttcatgggaaggctgctttga

DBGET integrated database retrieval system