KEGG   Thermococcus sp. 4557: GQS_02920Help
Entry
GQS_02920         CDS       T01588                                 

Definition
ribosomal biogenesis protein
Orthology
K14561  
U3 small nucleolar ribonucleoprotein protein IMP4
Organism
the  Thermococcus sp. 4557
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
563277..563909
Genome map
AA seq 210 aa AA seqDB search
MMLITTSHRPTRRTRSFGHDLEKVFPNSLYLTRGKKTVQDLLMEAYDRNYERLLIVNVWK
GNPLKMTFIKVDPEDWGYLGYMYLHGIKLQREIGFRDIRPIREEMPLVVTTAKRVGLDHV
AFAQVFAELTGGKFVPRKERSLLGIADRYNTDVLSVIERHPRGMAVNFYRLDVNKEKAVG
PLISVKIWIMEDGRRWDYKEAILKRGPSKE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgataacgacttcccacagacccacgaggaggacgaggagcttcggccacgac
ctagagaaggtcttccccaactccctctacctgaccaggggaaagaagacggtccaggac
ctgctcatggaggcctacgacaggaactacgagaggctcttgatagtcaacgtctggaag
gggaacccgctcaagatgacctttatcaaagttgaccccgaggactggggctacctcggc
tacatgtacctccacggcatcaagctccagcgcgagatcggttttagggatataaggcca
atacgcgaggagatgccgcttgttgtgaccaccgcaaagcgcgtcggactcgaccacgtt
gcctttgcccaggttttcgccgagctgaccggcggaaagttcgtcccgagaaaggagcgc
tcgctcctcgggatagccgacaggtacaacaccgacgttctgagcgtcatcgagaggcac
ccacgcggaatggcggtcaacttctaccgcctggacgtcaataaggagaaggccgttggt
cctctcataagcgtcaagatatggataatggaggacgggcggagatgggactacaaggaa
gcgattctgaagcgtggcccatcgaaggagtga

DBGET integrated database retrieval system