KEGG   Thermococcus sp. 4557: GQS_02990Help
Entry
GQS_02990         CDS       T01588                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
the  Thermococcus sp. 4557
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GQS_02990
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GQS_02990
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     GQS_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(572409..574268)
Genome map
AA seq 619 aa AA seqDB search
MYGYHNRIARVNLSTGRVTYEELPDEVIRKFVGGKGLGYYLIYREVPPGTDPLSPANKFV
FAPGGLTGLIPGSSKVIAVSKSPETGLISDSSGGDAFGPKLKGHFDALIIEGKAEEPVYL
YVHDGEVEIRDAKHLWGRGNYEVAKELWMEHPTASMALIGPAGEKLSRIANVIYDTERAS
GRGGLGAVLGSKKVKAVVVEPGEKPKVANPEEFQKLWQEFYDHFATDPKYEHTRNYGTSD
ALRSSASLGMSPAYNFSRPYIPDELASKLAGDEVKKYEVEPEWFVHGKSCPIKCARYVEV
EYKGRKIRVKPEYESIAMLGAATGVFNFPAVAYFNWLVNDLGLDSIATGATIGWVFEMVE
RGLLTEEEVGFPVKGFGDEEAEERLIKLMAERKGFGAIIADGVKRACERLGRGCEFAVHV
KGMESPAWDPRGRRTYALSYATADVGASHLRGWPRPHQLPNQGPAKELIPSLIEGRDESY
ITDMLGTCKFVSYKMEDLARLYSLATGEEWTVEKLRKVAQAVESIARIHDALDWVTPPLD
DTIPQRWWEPEPDGPAEGNAAFIDYNDFLEARKEFYLLRGWHEELGVPLPETMEELGYPE
FKDDAERALEVVKKRMNLE
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggctaccataacaggatagcccgggttaacctgagtactggaagggtgacctac
gaggaactgcccgacgaggtgattaggaagttcgtcggcgggaagggcctcggctactac
ctgatttacagggaagtgccaccgggaaccgacccgctaagcccggccaacaagttcgtc
ttcgcgccgggtggactgacgggcctcatacccggttcgagcaaggtcatagcggtcagc
aagagcccggagacggggcttataagcgactccagcggtggagacgccttcggtccaaag
ctcaagggacacttcgatgcgctcatcatcgagggtaaggccgaggagcccgtctacctc
tacgtccacgacggggaggtggaaatcagggatgcaaagcacctctggggcaggggcaac
tacgaggtagctaaagaactctggatggagcacccaactgcgagcatggcgctcatcggc
ccggccggcgaaaagctgagcaggattgccaacgtcatctatgacaccgagcgcgcgagc
gggaggggcggccttggagcggtcctcgggagcaagaaggtcaaagcggtggtcgttgag
cccggcgagaagcccaaagttgccaaccccgaggagttccagaagctgtggcaggagttc
tacgaccacttcgcaacagatccgaagtacgagcacacaaggaactacgggaccagtgat
gcgcttaggagctcggcctccctcggaatgagtccggcctacaacttctcacggccctac
atcccggacgagcttgcgagcaagctggcgggcgacgaggtcaagaagtacgaggtcgag
ccggagtggttcgtccacggcaagagctgtccgattaagtgcgctcgctacgtagaggtc
gagtacaagggcaggaaaatccgcgttaagcccgagtacgagagcatagcgatgctcgga
gcggcaactggcgttttcaactttccagcggtggcgtacttcaactggctcgtcaacgac
ctcggcctggacagcatagcgacgggagcgacgataggctgggtctttgagatggtcgag
aggggcctgctcaccgaggaggaggtaggcttcccggttaaaggcttcggcgacgaggaa
gctgaggagaggctcatcaagctcatggccgagaggaagggctttggggctataatagcg
gacggcgttaagagggcctgcgagcgcttgggtaggggttgcgagttcgcagtgcacgtg
aagggcatggagagccccgcctgggaccctcgcggaaggaggacctacgccctcagctac
gccaccgccgacgttggggcgagtcacctgaggggctggccgaggccgcaccagctgccc
aaccaggggcctgctaaggaactcatcccgtcgctgatagagggcagggacgagagctac
ataacggacatgctcggaacgtgcaagttcgtttcctacaagatggaggacctggcgagg
ctctactccctagcaaccggcgaggagtggacggtagagaagctcaggaaggtcgcgcag
gcagttgagagcatagcaaggatacacgacgccctcgactgggtcaccccaccgctcgac
gacacgattccacaacgctggtgggagcccgagccggacgggcctgcggagggcaacgcg
gcgttcatagactacaacgacttccttgaagcgaggaaagaattctacctgctgaggggc
tggcacgaggagctcggcgttccgttgccggagacgatggaggagctcggctatcctgag
ttcaaggatgatgcggagagggcgttggaagtcgtgaagaagaggatgaacctggagtga

DBGET integrated database retrieval system