KEGG   Thermococcus sp. 4557: GQS_03075Help
Entry
GQS_03075         CDS       T01588                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
the  Thermococcus sp. 4557
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GQS_03075
Enzymes [BR:the01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GQS_03075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
589390..590256
Genome map
AA seq 288 aa AA seqDB search
MDFLYTYETLKLEFPLVEPEEAAFTILGVPFDGTTSFKAGARFGPTLIRHATLNLESYVL
DYGIDIAELPIADIGDVAVVAGDPKKTTDRVRETVEELKKANPKTIPILLGGEHSQTLGA
VEALKPKSYVVFDAHLDLRESYEDNPYNHACVARRIGELGVREAMFGIRSGTREEVEYAE
REGIAWVHARDYDFDAFVELVKPLPEPVYLSVDIDAFDLSLVPSTGTPEAGGLRFWDVVE
AVEWLVENKRIAGFDIMEVAGSELGDVTALTAAKLLFYFIGAMGTRRP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggacttcctctacacttacgagactctcaagctcgagttcccgctcgtcgagccggaa
gaggcggccttcacgatcctcggcgtccccttcgacggcacgacgagcttcaaggcaggg
gcacgctttggaccgacgctcatcaggcacgcgacgctcaacctggagagctacgtgctc
gactacggcatcgacattgccgaactcccgatagcggacatcggggacgtcgcggttgtc
gcaggggacccaaagaagacgaccgacagggttagggagacggttgaggaactgaaaaag
gcgaatccaaagaccattccgatactcctcggcggtgagcactcccagacgcttggagcg
gtcgaggcactgaaaccgaagagctacgtcgtcttcgatgcccaccttgaccttcgcgag
agttacgaggacaacccatacaaccacgcctgcgtggctaggaggataggcgagctggga
gtcagggaagccatgttcgggataaggagcggcacgagggaggaggtggagtacgcggag
agggaaggtatagcgtgggtgcacgcgagggactacgacttcgatgccttcgtcgagctg
gtgaagcccctccctgagccggtttacctctcggtcgatatcgacgcgttcgacctttcc
ctggttccctcaaccggaacccccgaagcagggggtttgaggttctgggacgttgtcgaa
gccgtggagtggctagtggagaacaagagaatagcaggctttgacataatggaggtcgcg
gggagcgagcttggtgacgttaccgcgctgacggcggcaaagctgctgttctatttcata
ggggcgatgggaacgagaaggccctga

DBGET integrated database retrieval system