KEGG   Thermococcus sp. 4557: GQS_03295Help
Entry
GQS_03295         CDS       T01588                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
the  Thermococcus sp. 4557
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:the00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
632029..632847
Genome map
AA seq 272 aa AA seqDB search
MKFAGIDLSEPRIMGVINVSPESFYKGSVRDDGEGLIETAVKMVEDGATFIDIGAKSTAP
YLETQIPVEEEVRRAVWAVKAIRDHVDVPISIDTTSARVAEEALKAGADVINDVTGLKGD
AKMAEVATEYTAPVIVCAHGEVRNLSDPIHTVVDLLQGSIVIAEKHGIEEVAIDPAIGFL
RPEWPPWYEWDSKVLANLNMLKIFGRPILIGVSRKSFIGAITDRKDPLERLPGSLAATAV
AIFNGANIIRTHDVRETLDAVKMATFMRKFRM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcggggattgacctgagtgagcccaggataatgggcgtcatcaacgtttcg
cctgagagcttctacaaggggagcgtcagggacgacggggaggggctcatcgagaccgcg
gtgaagatggttgaggacggcgctaccttcatcgacatcggtgccaaatccacagccccc
tacctcgagacccagattccagttgaggaggaggtaaggcgggcggtatgggcggttaag
gccattcgcgaccacgtggacgtgccgataagcatagacacaacgagtgccagggtcgcg
gaggaggccctgaaggcgggcgcggatgtgataaacgacgtcaccggcctgaagggagac
gcgaagatggcggaggtcgcgactgaatataccgccccggtgatagtctgcgcccacggg
gaggtgaggaacctcagcgacccgattcataccgtggtggacctcctgcagggaagcata
gtcatagccgagaagcatggtatcgaggaggtagccatagacccggccataggcttcctc
cgcccggagtggcccccctggtacgagtgggactcaaaggttctggcgaaccttaacatg
ctcaaaatcttcggacggcccatcctcataggggtctccaggaagtcgttcatcggggcg
ataactgacagaaaagaccccttggagaggctcccggggagccttgccgccacggcggtg
gccatcttcaacggggcgaacataatcaggacacacgacgtcagggaaacactcgatgcc
gttaagatggcaacgttcatgaggaagttccggatgtag

DBGET integrated database retrieval system