KEGG   Thermococcus sp. 4557: GQS_03870Help
Entry
GQS_03870         CDS       T01588                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
the  Thermococcus sp. 4557
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
745905..747386
Genome map
AA seq 493 aa AA seqDB search
MERFILSLDEGTTSARAIIFDRESNVLSVGQYEFPQHYPKPGWVEHNPEEIWDAQFRAIK
TALERAKIEPSQIAAIGVTNQRETTIVWDRSGKPLHNAIVWQCRRTAEMVEKIKREYGDV
IKEKTGLVPDAYFSASKLKWLLDNVPGLREKAEKGDVLFGTVDTFLIYRLTGEHVTDYSN
ASRTMLFNIRRLEWDDELLEIFNIPEEVLPEVRESSEVYGYTKRELLGAEIPVSGNAGDQ
QAVLFGQAGFEAGMVKATYGTGSFILANTGKTVRYSNNLLTTIAWGLNGKITYALEGSVF
ITGAAVQWLRDGIRIIKSAPETEELARKLESNEGVYFVPAFVGLGAPYWDQFARGLIIGI
TRGTGREHLARATLEAIAYLTRDVVEEMERLVGIKELRVDGGATANDFLMEFQADILNRR
VVRPVVKETTALGAAYLAGLAVDYWESLEEIRSLWKAERVFEPTMDEETRGRLYRGWKEA
VKRAMGWAKVVGA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggttcatcctctccctcgacgagggaactacctcagccagagcaataatcttc
gacagagagagcaacgttctaagcgtcggccagtacgagtttccccagcactaccccaag
cccggctgggtcgagcacaacccggaagagatatgggacgcccagttcagggccatcaag
accgccctggagagggcaaagatcgaaccaagccagatagcggcgataggcgttactaac
cagcgcgaaacgacgatagtctgggacaggagcggtaagccgctccacaacgcgatagtc
tggcagtgccggagaacggccgagatggtggagaagataaagagggaatacggtgatgta
atcaaggagaaaacgggcctcgtgccggacgcatatttctcggccagcaagctgaagtgg
ctcctcgacaacgtcccaggtttgagggaaaaggccgagaaaggggatgttctcttcgga
acggttgatacattcctaatctaccgcctcaccggagagcacgtcacagactactccaac
gcctcaaggacgatgcttttcaacatcaggaggctcgaatgggacgatgagcttctcgaa
atcttcaacatcccagaggaggttctgcccgaggtcagggaatcgagcgaggtctacggc
tacaccaagagggaactcctcggtgcggagatacccgtcagcggcaacgcgggcgaccag
caggcggtactgttcggccaggcgggattcgaggcaggaatggtcaaggccacctatgga
acggggagcttcatcctggccaacacgggcaagaccgtccgctactccaacaacctgctc
acgacgatagcgtggggactcaacgggaagatcacatacgccctcgaggggagcgtcttc
ataaccggtgcggcagttcagtggctccgcgacggaatcaggataataaagagcgcgccc
gagaccgaagaactcgcgagaaaacttgagagcaacgagggggtctacttcgtcccggcc
ttcgtaggactcggtgccccctactgggaccagttcgcgagggggctgataatcggcata
acgcgcggaaccggcagggagcacctcgcgagggcgactttagaggccatagcatatctg
acgcgcgacgtggtcgaggagatggagaggctcgtcggaataaaggagctccgcgtcgat
gggggagcgactgcgaacgacttcctgatggagttccaggcggacatactcaacaggcgc
gtcgtcaggcccgtcgtgaaggagaccacagccttgggggcggcatatctggcaggcctc
gccgtcgattactgggagagcctcgaggagataaggagcctgtggaaggcggagagggtc
tttgaaccgacgatggacgaagaaacgagggggcggctctaccgcggctggaaggaggcc
gtgaaaagggcgatgggctgggcgaaggttgttggggcctga

DBGET integrated database retrieval system