KEGG   Thermococcus sp. 4557: GQS_04065Help
Entry
GQS_04065         CDS       T01588                                 

Definition
(GenBank) Phosphoglucomutase (pgm)
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
the  Thermococcus sp. 4557
Pathway
the00010  Glycolysis / Gluconeogenesis
the00030  Pentose phosphate pathway
the00051  Fructose and mannose metabolism
the00052  Galactose metabolism
the00230  Purine metabolism
the00500  Starch and sucrose metabolism
the00520  Amino sugar and nucleotide sugar metabolism
the00521  Streptomycin biosynthesis
the01100  Metabolic pathways
the01110  Biosynthesis of secondary metabolites
the01120  Microbial metabolism in diverse environments
the01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_04065
   00030 Pentose phosphate pathway
    GQS_04065
   00051 Fructose and mannose metabolism
    GQS_04065
   00052 Galactose metabolism
    GQS_04065
   00500 Starch and sucrose metabolism
    GQS_04065
   00520 Amino sugar and nucleotide sugar metabolism
    GQS_04065
  Nucleotide metabolism
   00230 Purine metabolism
    GQS_04065
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GQS_04065
Enzymes [BR:the01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     GQS_04065
    5.4.2.8  phosphomannomutase
     GQS_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AEK72714
UniProt: G0HP16
Position
complement(781951..783318)
Genome map
AA seq 455 aa AA seqDB search
MGRLFGTFGVRGIANEMITPEFALKMGMAFGTMLKREGREKPLVVVGMDTRVSGEMLKGA
LISGLLSTGCDVIDVGIAPTPAIQWATDHFKADGGAVITASHNPPEYNGIKLLEPNGMGL
KKEREAVVEEVFFKEDFDRARWDEIGDVRKEDVIRPYIEAIKSRVDVEAIKKRRPFVVVD
TSNGAGSLTLPYLLRELGCKVVSVNAHPDGHFPARNPEPNEENLKGFMEIVKALGADFGV
AQDGDADRAVFIDENGRFIQGDKTFALVADAVLRENGGGLLVTTIATSNLLDDIARRNNA
EVMRTKVGDLIVARALLEHNGTIGGEENGGVIFPDFVLGRDGAMTAAKIVEIFAKSGKKF
SELIDELPKYYQFKTKKHVEGDRKAIVAKVAELAEKRGCTVDTTDGTKILFEDGWVLVRA
SGTEPIIRVFSEAKSEEKAEEYLELGLNLLEAALG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggctgttcggtaccttcggcgtcagggggatagccaacgaaatgataacccca
gagtttgccctcaagatgggcatggccttcggaacgatgctcaagcgcgaggggagggag
aaacccctggtagtggtcggcatggacacccgcgtcagcggggagatgctcaagggcgcg
cttataagcggccttctcagcaccggctgcgacgtcatcgacgttggcatcgcgcccacc
cctgcgatccagtgggcaacggatcactttaaagcggacggcggggccgtaataactgcc
agccacaacccgcccgaatacaacggcataaagctgctcgaaccaaacggcatggggctg
aagaaggagcgcgaagccgtcgtggaggaggttttcttcaaagaggacttcgacagggcc
agatgggacgagataggcgacgtcaggaaggaggacgtcatcaggccctacatcgaggcg
ataaagagcagggttgacgttgaggcgatcaaaaagcggagacccttcgtggtcgtggac
acatccaacggtgcaggcagtctaacgctcccctacctcctccgcgagctcggctgcaag
gtcgtcagcgtcaacgcccatccggacggccacttcccggccagaaacccggagccgaac
gaggagaacctgaagggcttcatggagatcgtgaaggccctcggtgccgactttggggtt
gcccaggacggcgacgccgacagggcggttttcatagacgagaacggcaggttcatacag
ggcgacaagaccttcgctctggttgccgatgcagttctgagggagaacggcggagggctt
ctcgtcacgacgatagccacttcaaaccttctcgacgatatagcgaggaggaacaacgcg
gaagtcatgagaacgaaggtcggcgacctcatcgttgcgagggctctcctcgagcacaac
ggaaccatcggcggcgaggagaacggcggcgttatcttcccggacttcgtcctcggcagg
gacggggcgatgacggcggcaaagatagtcgagatcttcgcgaaatccggcaagaagttc
agcgagctgatagatgagctgccgaagtactaccagttcaagacgaagaaacacgttgaa
ggggacagaaaggccatagttgccaaggtcgccgagctcgctgagaagaggggctgcact
gttgacaccaccgacgggactaaaatcctcttcgaggacggctgggttctcgtcagggcc
agcgggacggagccgataatcagggtcttcagcgaggccaagagcgaggagaaggccgag
gagtaccttgagctgggattgaaccttttggaagcggcactgggctga

DBGET integrated database retrieval system