KEGG   Thermococcus sp. 4557: GQS_04380Help
Entry
GQS_04380         CDS       T01588                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GQS_04380
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GQS_04380
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GQS_04380
Enzymes [BR:the01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GQS_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(847316..848647)
Genome map
AA seq 443 aa AA seqDB search
MKVRCPSCGRLYSSLIPPGCSCGERLEIPYDYEKVDPSRWRNREPGVWRYRELLPDVPEV
VSLREGGTPLIRAKLGRELGLNVFIKDETRNPTGSFRDRLTTVAVSYGLPHAENGFVVAS
NGNAAASLAAYAARAGRPAYTVVPKLVEQGKLNQIVALGAKLIRYGESVDEGINYAEGLA
EGRGLYNVTPESNLIGLEGQKTLAFELWEDLNPTHVIVPTGSGSNLYSIYKGFKELIEVG
VVDEMPKLIAVQAEKCSPIASEVLGVEPRAEPTKALALYVKSPVMKELALEAIHASGGTA
VLVGEDELDLGQRLLAGEGIFAEYASSVIVPALLKLAEENYFERDDRIALIVTSSGLKGH
YSESREKFTVGGTKLEILKLLSGRSMYGYEIWEALEKPLKYQAVYQHLRELESMGLIEET
HRKGRRVYYGLTERGRRFLETIG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccgctgtcccagctgcgggcgtctctattcttcccttattccccctgggtgc
tcctgcggggagcgtctggagataccctacgattacgagaaagtcgacccgtccaggtgg
cggaaccgtgaacccggtgtctggagataccgggagcttctgccggacgtccctgaggtc
gtgagccttcgggaggggggtacgcccctcataagggccaaactcggccgcgagcttggg
ctcaacgtcttcatcaaggacgagaccaggaaccccaccggctccttcagggaccgtctc
acgaccgttgccgtttcctatggccttccccacgcagaaaacggctttgtggtggcgagc
aatgggaacgcggcagcttcccttgccgcttacgccgccagagccggcagaccagcctac
accgtcgtgccgaagctcgtggagcagggcaagctcaatcagatagtggccctcggggca
aagctcatacggtacggggagagcgtggacgagggcataaactacgcggaggggctggct
gagggcagggggctctacaacgtcacccccgagagcaatctcatcggtctggaggggcag
aaaacgctggccttcgagctctgggaggatttgaacccgacgcacgtgatagtcccgact
ggaagcggcagcaacctctacagcatctacaagggtttcaaggagctcatcgaggtgggt
gtggttgatgagatgccgaaactgatcgccgttcaggccgagaagtgctcccccatagcg
agcgaggtgcttggagttgagccgcgggccgagccgaccaaggcgctggccctgtacgtg
aagagcccagtcatgaaagagctcgccctggaggctatacacgccagcgggggaaccgct
gttctcgtcggcgaggacgagcttgacctggggcagcggctccttgccggggaggggata
ttcgcggagtacgcctcttcggttatcgtccctgcactcctcaaactggcggaggagaat
tatttcgaacgcgacgacaggatagcccttatagttacaagttcgggcctcaagggacac
tactccgagagcagggagaagttcaccgtcggcggaaccaagctcgagatactgaagctg
ctgagcgggaggagcatgtacggctatgagatatgggaggcactggagaagccgctcaag
taccaggccgtttaccagcaccttcgcgagctcgagagcatggggcttatcgaggagacc
cacagaaaggggagacgggtctattacgggctgacggagaggggcaggaggttccttgag
accatagggtag

DBGET integrated database retrieval system