KEGG   Thermococcus sp. 4557: GQS_05190Help
Entry
GQS_05190         CDS       T01588                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
the  Thermococcus sp. 4557
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    GQS_05190
Enzymes [BR:the01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     GQS_05190
    3.5.1.-  
     GQS_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(976590..977135)
Genome map
AA seq 181 aa AA seqDB search
MPEEALIVVDMQRDFMPGGALPVPEGDRIIPRCNRYIEEFRKRGALIVATRDWHPENHVS
FREQGGPWPRHCVQNTPGAEFVVELPADAVIISKATEPDKEAYSGFEGTNLAEILKRNGV
RRVYVCGVATEYCVKATALDAVKNGFETYLLRDAVKGIKPEDEERALGEMERAGVKVLYL
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggaggcgctcatcgttgttgacatgcagagggatttcatgccagggggagcc
ctgccggttccagagggagacaggataataccccggtgcaaccgctacatcgaggagttc
aggaagaggggggctttgatagttgccacgcgcgactggcatcccgagaaccacgtcagc
tttagggagcagggcggcccgtggccgaggcactgcgttcaaaacactcccggggcggag
ttcgtcgttgaactccccgccgatgctgtgataatctcaaaggccacggagcccgataag
gaggcctattcgggattcgaggggacgaacctggcggagatactgaagagaaacggggta
aggagggtttacgtctgcggcgtcgctacggagtactgcgttaaggcaacggccctcgat
gcggttaagaacggcttcgagacctacctcctccgcgacgcagtgaagggcattaagcct
gaggatgaggagcgggctttgggggagatggagagggccggcgtgaaggttctctacctg
atataa

DBGET integrated database retrieval system