KEGG   Thermococcus sp. 4557: GQS_06035Help
Entry
GQS_06035         CDS       T01588                                 

Definition
hypothetical protein
Organism
the  Thermococcus sp. 4557
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1136908..1138191
Genome map
AA seq 427 aa AA seqDB search
MKRAEVVLSLAAVAGATAYLTGSPAGALVAAMMMAHYALARLGFTPDVRIVRELPARGME
KEPVKAKIEVTNESNMGGTLHIAETSEKLFARGLKIPLRPGERKYLEQTIVPQSKGRVRP
KARAVFEDPLGLFRKEFPVEEHGEMTVLPSLRSIREAMRERHQVEALAEAEKALGVGAEV
LDFEELREFLPGDDISKIDWKATSRLQTIIVRVFKRETLSDIYILVNVDGKFRREIKRGK
IDYLVLIITQLTAYFRKFGHTVRVVAYDDAGVVGVIEHAADPLIVTSKLDLREEKGLPPL
RPASPSPASSIGKLALKLRRGSTATGIVKAAMGIEPGAYVVMVDDLGLHPGEIIKAARIL
RRKGNKAVLIYPNPILFADRKGLGERELESLYTAYRERKRVMRKVMGWINVIEVGPGDVL
PKVVRRL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaagagggcagaagtggtactctcgctggcggcagtggcaggggcgaccgcataccta
acgggcagcccggccggggcccttgtcgcggccatgatgatggcccactacgccctggca
aggctgggcttcacaccggacgtcaggatagtccgggagctgccggcaagggggatggaa
aaggagccggtgaaagccaagatagaggtcaccaacgaatcgaacatgggaggtacgctg
cacatagccgaaacctccgagaagctcttcgccagagggctgaaaatccccctgaggccg
ggagaacggaagtacctggaacagaccatcgtcccacagtcaaagggcagggtgcgccca
aaggcaagggcggtgtttgaagacccgctcgggctcttcaggaaggagttccccgtcgag
gagcacggggagatgaccgttctcccctcgctcaggagcatacgcgaggccatgcgtgag
aggcatcaggttgaagccctcgcagaggcggagaaggccctgggggttggagcggaggtc
ctggacttcgaggagctgagggagttcctgcccggcgacgacatatccaagatagactgg
aaggcaacgtcgaggctgcagaccatcatagtgagggttttcaaacgcgagaccctgagc
gacatctacatcctcgtcaacgtcgacgggaagttccgacgcgagataaagaggggcaag
atagactacctcgtcctcataatcacccagctcaccgcgtacttcagaaagttcggtcac
acggtcagggtcgtcgcctacgatgacgccggggtggtgggggtcatcgaacacgcggcg
gatcccctcatcgtcacatcaaagctcgatctcagggaggagaagggtctgccgcccctg
aggccggcgagtccatcccccgcgtcctcaatcggcaaactggccctcaagctcaggagg
ggctccacggccaccgggatcgtgaaggcggcgatgggcatcgaacccggggcctacgtg
gttatggtggacgacctcggcctgcatcccggcgagatcatcaaggcggccagaatcctc
aggagaaaagggaacaaggcagtactgatttaccccaacccaatcctcttcgcagacaga
aaaggcctgggtgagagggagctggaatccctgtacacagcgtaccgcgagaggaaacgg
gtcatgaggaaggtcatgggatggatcaacgttatcgaagtggggccgggagacgtcctt
ccgaaggtggtgagaaggctatga

DBGET integrated database retrieval system