KEGG   Thermococcus sp. 4557: GQS_06050Help
Entry
GQS_06050         CDS       T01588                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
the  Thermococcus sp. 4557
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GQS_06050
   00500 Starch and sucrose metabolism
    GQS_06050
Enzymes [BR:the01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     GQS_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139553..1140455)
Genome map
AA seq 300 aa AA seqDB search
MRVGALFLMLLLMEAGIVGAYPITVDGDPSDWPSELDIQNSGISPGESGYVNGVWVFHDL
SDDLNQYGGDNPGYDIKYFMITFDDTYAFFLMVLNSPAVFDSPESPLVIIALGNEQYQGG
KNGFDPTIYTGSGAPWNPLGSDVQTSKVWQREIVVNLSRISGNSIISGSNAAFWVYNSVS
EGNVNSSNDLAAVNYDNGVVELRVRRDELYLQPGSGVNSFYPYALIANRTKYGTEWYTQY
YYLAMDVMSNVTTDDEVGDGKIDYSPAVDVSQVPFFGGDLSRAALVVLLVVGAILLFGRR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcggggcgttgtttttgatgctactgctgatggaagcaggtatcgttggggca
taccccattacagttgatggagatccctccgattggccctccgagctggatattcagaat
tccgggatatccccaggggaatccgggtacgtaaatggggtctgggtttttcatgatttg
tcggacgacctgaaccagtacgggggtgataaccccggctatgatatcaagtacttcatg
ataacgttcgatgatacgtacgcgttcttcctgatggttctcaacagtcccgcggtgttt
gacagccctgagtctccccttgtgataatcgccctcggcaatgaacagtaccagggaggg
aaaaatgggtttgacccgaccatctacaccggttcaggggccccgtggaatcccctaggc
agcgacgttcagacctcaaaggtctggcagagggagatcgtggttaatctcagcagaatt
tccggaaactcaatcatcagcggctcaaacgccgcgttctgggtttacaactcggttagc
gaggggaacgtcaacagctcaaatgacctcgccgcggtcaactacgataatggggttgtt
gaactcagggttagacgggacgagctgtacctccagcccggttcgggggtgaacagtttc
tatccctacgctttgatcgccaacaggacgaaatacggtactgaatggtatacgcaatat
tattatctcgccatggatgtgatgtccaatgtcacaactgatgatgaggtgggcgacggg
aagatcgactattcgcccgcggttgatgtttcccaggttcccttcttcggcggtgacctg
tcaagggcggcgctggtggtgctgttggttgttggtgccatcctgctcttcgggaggcgg
tga

DBGET integrated database retrieval system