KEGG   Thermococcus sp. 4557: GQS_06050Help
Entry
GQS_06050         CDS       T01588                                 

Definition
hypothetical protein
Organism
the  Thermococcus sp. 4557
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1139553..1140455)
Genome map
AA seq 300 aa AA seqDB search
MRVGALFLMLLLMEAGIVGAYPITVDGDPSDWPSELDIQNSGISPGESGYVNGVWVFHDL
SDDLNQYGGDNPGYDIKYFMITFDDTYAFFLMVLNSPAVFDSPESPLVIIALGNEQYQGG
KNGFDPTIYTGSGAPWNPLGSDVQTSKVWQREIVVNLSRISGNSIISGSNAAFWVYNSVS
EGNVNSSNDLAAVNYDNGVVELRVRRDELYLQPGSGVNSFYPYALIANRTKYGTEWYTQY
YYLAMDVMSNVTTDDEVGDGKIDYSPAVDVSQVPFFGGDLSRAALVVLLVVGAILLFGRR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcggggcgttgtttttgatgctactgctgatggaagcaggtatcgttggggca
taccccattacagttgatggagatccctccgattggccctccgagctggatattcagaat
tccgggatatccccaggggaatccgggtacgtaaatggggtctgggtttttcatgatttg
tcggacgacctgaaccagtacgggggtgataaccccggctatgatatcaagtacttcatg
ataacgttcgatgatacgtacgcgttcttcctgatggttctcaacagtcccgcggtgttt
gacagccctgagtctccccttgtgataatcgccctcggcaatgaacagtaccagggaggg
aaaaatgggtttgacccgaccatctacaccggttcaggggccccgtggaatcccctaggc
agcgacgttcagacctcaaaggtctggcagagggagatcgtggttaatctcagcagaatt
tccggaaactcaatcatcagcggctcaaacgccgcgttctgggtttacaactcggttagc
gaggggaacgtcaacagctcaaatgacctcgccgcggtcaactacgataatggggttgtt
gaactcagggttagacgggacgagctgtacctccagcccggttcgggggtgaacagtttc
tatccctacgctttgatcgccaacaggacgaaatacggtactgaatggtatacgcaatat
tattatctcgccatggatgtgatgtccaatgtcacaactgatgatgaggtgggcgacggg
aagatcgactattcgcccgcggttgatgtttcccaggttcccttcttcggcggtgacctg
tcaagggcggcgctggtggtgctgttggttgttggtgccatcctgctcttcgggaggcgg
tga

DBGET integrated database retrieval system