KEGG   Thermococcus sp. 4557: GQS_06265Help
Entry
GQS_06265         CDS       T01588                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
the  Thermococcus sp. 4557
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:the01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:the00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1196713..1197981
Genome map
AA seq 422 aa AA seqDB search
MSEALEKVSQEIEKLQDEMVKALVELIKIPAISPDYGYEGEYDKAQKLLEMIKDWPFDKV
EVYNAPDERAKNGVRPSILAYYYGQDGEKSPRIWILTHIDVVPPGDMSKWTVTEPFKPVV
KDGKIYGRGSEDNGQSLVASLYAVKAMMNLGIRPKRTVILAFVSDEETGSKYGVEWLMRE
HPELFRKDDLVLVPDGGNEDGTFIEVAEKSILWLRVKVRGKQVHASMPDKGLNAHRVALD
FAYHLDRFLHEKYGERDELFDPPESTFEPTMVHGPADSPNIAPGEHEVVFDCRILPRYSI
DDILADAKALAEEVKEKYRKEFDGKVLPEIELEILQRMDAPEPTDPNSEIVRLLQEALRR
LRGKEAKVGGIGGGTFAAYFRKLGIPAVVWATLDEMAHQPNEYAWIKNLVEDAKVMAALA
LL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcccttgagaaggtctcgcaggagattgagaagctccaggacgagatggtg
aaggccctcgtcgaactgatcaagatacccgccataagcccggactacggctacgagggc
gagtacgacaaggcccagaagctgctcgagatgataaaggactggcccttcgacaaggtc
gaggtctacaacgcgccggacgagagggccaagaacggcgtcaggccgagcattctcgcc
tactactacggccaggacggcgagaagagcccgaggatatggatcctcacccacattgac
gtggttccgcccggggacatgagcaagtggacggtcaccgagcccttcaagccggtcgtc
aaggacggaaagatctacggcaggggaagcgaggacaacgggcagagccttgtggcttcc
ctctacgcggtaaaggccatgatgaacctcgggataaggccgaagagaacggtcatcctg
gcatttgtcagcgacgaggagaccggcagcaagtacggcgtcgagtggctcatgagggag
caccctgagctgttcaggaaggacgacctggttctcgtccccgacggcggaaacgaggac
ggaaccttcatcgaggtggccgagaagagcatcctctggctcagggtgaaggtcaggggc
aagcaggttcacgccagcatgccggacaagggactcaacgcccaccgcgtggccctcgac
ttcgcctaccacctcgacagattcctccacgagaagtacggcgagagggacgagctcttc
gacccgccggagagcacctttgagccgacgatggttcacggcccggcagacagcccgaac
atagcccccggcgagcacgaggtggttttcgactgcaggattctgccgaggtacagcata
gacgacatcctcgccgacgccaaggcccttgccgaggaggtcaaggagaagtacagaaag
gagttcgatggaaaggttctgcccgagatagagctcgagattctccagcgcatggacgcc
ccggagccaaccgatccgaacagcgagatagtgaggctcctccaggaggcgctcaggagg
ctccgcggaaaggaagccaaggtaggcggaataggcggcggaaccttcgcggcatacttc
aggaagctcggaattccggccgtcgtctgggcgacgctcgacgagatggcccaccagccc
aacgagtacgcctggataaagaacctggtggaagacgccaaggtcatggcggccctggct
cttctctga

DBGET integrated database retrieval system