KEGG   Thermococcus sp. 4557: GQS_06320Help
Entry
GQS_06320         CDS       T01588                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
the  Thermococcus sp. 4557
Pathway
the00010  Glycolysis / Gluconeogenesis
the00020  Citrate cycle (TCA cycle)
the00620  Pyruvate metabolism
the01100  Metabolic pathways
the01110  Biosynthesis of secondary metabolites
the01120  Microbial metabolism in diverse environments
the01130  Biosynthesis of antibiotics
the01200  Carbon metabolism
Module
the_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_06320
   00020 Citrate cycle (TCA cycle)
    GQS_06320
   00620 Pyruvate metabolism
    GQS_06320
Enzymes [BR:the01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GQS_06320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: AEK73162
UniProt: G0HJR9
Position
1205588..1206406
Genome map
AA seq 272 aa AA seqDB search
MTDEEVRMIAEQYEIDLSKLEGSGPGGEVTLEDLERYIKEHFYPKVLREVNLIGIRKVIA
GRLSESYREAVHVTINMEVEMDGLVKMRKKLTEKLGRKPSYTVLMLKCIAKAIRDFIDVN
ATMDGDKITVYDDININVAVDSPIGLITPVIRNVDEKSLEELLDEYSNLVERTKKGLLKE
KDFVGGTFTVTNLGMLEVDSFTPIINPPQVAILGLNRIAEKPVVRNGEIKKARVMTLSLS
FDHRAIDGAPAARFLGRVKHYLENPEEVFGDL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgaagaggtcaggatgatagcggagcagtacgagatagacctctcgaagctt
gagggctcagggccgggtggtgaggtaaccctcgaagaccttgagaggtacatcaaagag
cacttctacccgaaggttctgagagaggtcaacctcatcgggataaggaaggtgatagcg
ggaaggctctccgagagctaccgagaggcagtccacgtcacaatcaacatggaggtggag
atggacgggctcgttaagatgaggaaaaaacttaccgagaagctcgggaggaagccgtcc
tacaccgtgctcatgctgaagtgcatagcaaaggcaatcagggacttcatagacgtgaac
gcaacgatggacggggacaagataacggtttacgacgacatcaatataaatgtggccgtc
gacagcccgatagggctgataactccggtaatcaggaacgttgacgagaaaagccttgag
gaacttctcgatgagtactccaacctcgtggagcggacgaagaagggcctcctgaaggaa
aaggacttcgtcggggggaccttcacggtcacgaacctgggaatgctggaggttgactcg
ttcaccccgataataaacccaccccaggtggcgattctgggcctcaatagaatagccgaa
aaaccggttgtgaggaacggagagataaaaaaggccagggtcatgaccctgtccctgagc
ttcgaccacagggcgatagacggtgctccagcagcgaggttcctgggacgggtgaagcac
tacctggaaaaccccgaagaagtcttcggagacctgtga

DBGET integrated database retrieval system