KEGG   Thermococcus sp. 4557: GQS_07225Help
Entry
GQS_07225         CDS       T01588                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GQS_07225
   01230 Biosynthesis of amino acids
    GQS_07225
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_07225
   00051 Fructose and mannose metabolism
    GQS_07225
   00562 Inositol phosphate metabolism
    GQS_07225
Enzymes [BR:the01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     GQS_07225
Exosome [BR:the04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   GQS_07225
  Exosomal proteins of bladder cancer cells
   GQS_07225
  Exosomal proteins of melanoma cells
   GQS_07225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1386799..1387479)
Genome map
AA seq 226 aa AA seqDB search
MSKLKEPIIAINFKTYAQATGEGALRIAKAAEKVWKETGITIVVAPQLADLYRIAQEVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEASIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKRVNPDVKVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLVSLIL
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagctgaaggagccgattatagcgatcaacttcaagacctacgcccaggccacg
ggcgagggtgccctgaggatagccaaggccgccgagaaggtctggaaggagacgggcata
accatcgttgttgcgccgcagcttgccgacctctacaggatagcccaggaggtcgagatt
cccgtcttcgcccagcacatcgatccgataaagcccggaagccacaccggccacgttctg
ccggaggccgtgaaggaggctggggcggttggaacgctcctcaaccactcggagaacaga
atgattctcgcggatttggaggccagcataaggcgcgccgaggaagttggtctgatgacg
atggtctgctccaacaatccggcggtttcagcggcggtggcagcactcgggccggactac
gttgccgtcgagccgcctgagctcataggcaccggtattccggtcagcaaggccaagccc
gaggtcatcaccgacacggtcgagcttgttaagagggtcaatccggacgttaaggttctc
acgggcgcggggatttccactggagaggacgtcaagaaggctttggagctcggaagcgtc
ggagttctcctcgcgagcggagttacaaaggccaaagacccggagaaggcgataagggat
ctggtgtcgctgattctctga

DBGET integrated database retrieval system