KEGG   Thermococcus sp. 4557: GQS_07935Help
Entry
GQS_07935         CDS       T01588                                 

Definition
(GenBank) aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
the  Thermococcus sp. 4557
Pathway
the00010  Glycolysis / Gluconeogenesis
the01100  Metabolic pathways
the01120  Microbial metabolism in diverse environments
the01200  Carbon metabolism
the01230  Biosynthesis of amino acids
Module
the_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
the_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_07935
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     GQS_07935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C DUF1560
Motif
Other DBs
NCBI-ProteinID: AEK73483
UniProt: G0HLL0
Position
1509172..1511130
Genome map
AA seq 652 aa AA seqDB search
MKFTVLRLNLDEKKVESEELERNGIYGVIDYGIEIHENLETYKVEPYDPKNVVIMGMGPF
SGSTLPGAHRLMFFFRSPLYGTLFPSAMGGAAYAFKNVGVDFVTFEGKAEKPVVVLLYND
GESVRVELHEIELEKVVEIWRGYKDEEGVYALTQYLIDTFGDKFDFEYRIAVVGPSALNT
NYGAIFSQALRKGERLVGSEDWAARGGSGSVLLRAHNVVGIIFGGKPRRRTFPGEDISSF
RTAKGIVEGVHKKPYNEIIAEKTTKYRFNPKLNTGGTFGGNYPAEGDFVPILNWQMPYIP
KEERIRIHENIMKHYWEPFNEEAIKPKNWTTCGEPCPVVCKKYRRGHHVEYEPYEANGPL
SGSISLRASDVSVHAADAMGFDAIEFGGTAAWVLELVHRGLLKPEEVGISGKPEFTKEAL
LERPVEASEVNAKLVAELAHRVAFGENEIARIIGLGKRKASVIFDERFKDRLKYGESFKD
YGVFVPLGENGEMTPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELAQKIIASALWEF
WYDNVGWCRFHRGWMKPVLRALFMDTYGENVDMEEHARKQLKRLIEYARKAGYAPAFWDS
MRVIDLVAAGSEEFGNERWAERFRVDKVGTAKEYLSRVLEAYSEILGVEWRL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacagttctcaggctcaatctggacgagaagaaggtggagagtgaggagctg
gagaggaacgggatatacggggtcatagactacggcatagagattcacgagaacctcgaa
acctacaaggttgagccatacgaccccaagaacgtcgttatcatgggtatggggcccttc
tcaggctcgaccctgcccggggcccacaggctcatgttcttcttccgctcaccgctctac
ggaacgctcttcccctccgcaatgggcggtgccgcttatgccttcaagaacgtcggcgtt
gatttcgtgaccttcgagggcaaggccgagaagcccgtcgtggttctcctctacaacgac
ggcgagagcgtaagggttgaactccacgagatcgagcttgagaaggtcgttgaaatctgg
aggggctacaaggatgaggaaggagtctatgccctcacgcagtacctcatcgatacattt
ggcgataagttcgacttcgagtaccgcatagcagtcgtcggcccctccgccctaaacacc
aactacggcgcaatattctcccaggccctcaggaagggagagaggctcgtaggcagcgag
gactgggccgcccgcggaggctcaggaagcgttctcctccgtgcccacaacgtcgttgga
attatcttcggcggaaagccgaggaggagaaccttcccgggcgaggacatctcatcgttt
agaaccgccaagggcatcgtcgagggcgtccacaagaagccctacaacgagataatagcc
gagaagacgaccaaataccgcttcaaccccaagctcaacaccggcggaaccttcggcggc
aactacccggccgagggggacttcgttccgatactcaactggcagatgccctacattccg
aaggaggagcgcataaggattcacgagaacataatgaagcactactgggagcccttcaac
gaagaggctataaagccgaagaactggacgacctgcggcgagccgtgcccggtggtctgc
aagaagtaccgtcgcggccaccacgtcgagtacgagccctacgaggccaacggtccgctc
agcgggagcataagtctgagggccagcgacgtaagcgttcacgccgccgatgcgatgggc
ttcgacgccatagagttcggtggaaccgcagcgtgggtccttgagctcgtccaccgcggt
ctgctcaagccggaggaagtgggcataagtggaaagcccgagttcacgaaggaggcactc
ctcgagaggccggtggaggcgagcgaggtcaacgcgaagctcgtggcggagctggcccac
cgcgtcgccttcggcgagaacgagatagcaaggataatcggcctcggcaagaggaaggcg
agcgtaatcttcgacgagcgctttaaggacaggctcaagtacggcgagagcttcaaggat
tacggcgtcttcgttccgctcggcgagaacggcgagatgacgccgacgatgtactgggcg
ataggcaactacataccgctcccgattcagggaagatactggacgttctaccagttcggc
gtcttccttgagccggaggagctcgcgcagaagataatcgcctcggccctctgggagttc
tggtacgacaacgtcggctggtgccgcttccacaggggatggatgaagcccgtcctcagg
gcgctcttcatggacacctacggggagaacgttgacatggaggagcacgccaggaagcag
ctcaagaggctcatcgagtacgcgagaaaggccggctacgccccggcattctgggactcg
atgcgcgttatagacctcgtcgccgccggaagcgaggagttcggcaacgagcgctgggcc
gagaggttcagggtcgacaaggtcggaacggcaaaggagtaccttagcagggtcttggag
gcctacagcgagattctgggagtggagtggaggctgtga

DBGET integrated database retrieval system