KEGG   Thermococcus sp. 4557: GQS_08055Help
Entry
GQS_08055         CDS       T01588                                 

Definition
(GenBank) carbohydrate/pyrimidine kinase
  KO
K21056  
alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
the  Thermococcus sp. 4557
Brite
Enzymes [BR:the01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     GQS_08055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1531251..1532174
Genome map
AA seq 307 aa AA seqDB search
MPRSFHRRGERMAEFDVVGIGNLNYDIIMLIERFPEFHEKINAEEAFFGLGGAAANTISW
LAHFGLRTGYVGAVGRDEIGEAHLSYFRRIGVDTGGIRVVDVPSGVAIAMIRGEDKRIVK
YPGANLLKEVDFDYLSRARHVHLSSNPMETIERVVEFANEGGITVSLDIGEAPLSREIEE
KVDYLMMNEDEYRRKFGSLDLSLSGAKNLVVTLNGGGALVRDASGNVHEIRGLSAEVVDS
TGAGDSFDAGVIYGVLNGWGLDDAARLGMLLAYLTVQKVGARSAVMSLAEVIAVAREVGL
SLPFGRD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtagcttccaccgcaggggtgagaggatggcggagttcgatgtggtgggaatc
ggcaaccttaactacgacatcataatgctcatcgagcgttttccggaattccacgagaag
atcaacgcggaggaagctttcttcggcctcggcggcgccgccgcgaataccataagctgg
ctcgcgcacttcggcctgagaaccggttacgtaggcgccgtcgggagagacgagataggt
gaggcgcacctctcgtacttcaggaggataggcgttgatacgggcgggataagggtcgtc
gatgtcccatcgggtgtggccatagctatgatacgcggggaggacaagaggatagtgaag
taccccggtgcgaacctcctcaaggaggtcgattttgactacctctccagggcgcggcac
gttcacctctcgtcgaacccgatggagacgatagagagggtggtggagttcgcgaacgag
ggggggataaccgtttccctggacataggggaggccccgctgtcgagggaaatcgaggag
aaggtcgattacctgatgatgaacgaggacgagtaccggaggaagttcggttccctcgac
ctttccctttccggggccaaaaacctcgtggtcaccctgaacgggggaggggcgctggtc
agggacgcctccggaaacgttcacgaaatccgagggctcagcgcggaggtcgttgattcc
accggcgcgggtgactcgtttgacgcgggcgttatctacggagtcctcaacggatggggg
ctggacgacgccgcgaggctcgggatgctcctggcgtacctcaccgtccagaaggttggg
gccagaagcgcggtgatgtcccttgcagaggtcatagccgttgcccgcgaggtgggtctc
agcctgcccttcggcagggactga

DBGET integrated database retrieval system