KEGG   Thermococcus sp. 4557: GQS_08115Help
Entry
GQS_08115         CDS       T01588                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
the  Thermococcus sp. 4557
Pathway
the00010  Glycolysis / Gluconeogenesis
the00020  Citrate cycle (TCA cycle)
the00620  Pyruvate metabolism
the00640  Propanoate metabolism
the00650  Butanoate metabolism
the00680  Methane metabolism
the00720  Carbon fixation pathways in prokaryotes
the01100  Metabolic pathways
the01120  Microbial metabolism in diverse environments
the01130  Biosynthesis of antibiotics
the01200  Carbon metabolism
Module
the_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_08115 (porA)
   00020 Citrate cycle (TCA cycle)
    GQS_08115 (porA)
   00620 Pyruvate metabolism
    GQS_08115 (porA)
   00640 Propanoate metabolism
    GQS_08115 (porA)
   00650 Butanoate metabolism
    GQS_08115 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GQS_08115 (porA)
   00680 Methane metabolism
    GQS_08115 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GQS_08115 (porA)
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GQS_08115 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: AEK73519
UniProt: G0HLX6
Position
complement(1541950..1543134)
Genome map
AA seq 394 aa AA seqDB search
MPIRKVMKANEAAAWAAKLAKPKVIAAFPITPSTLVPEKISEFVADGELDAEFIKVESEH
SAISACVGASAAGVRTFTATASQGLALMHEILFIAAGMRLPIVIAVGNRSLSAPINIWND
WQDTISERDTGWLQFYAENNQEALDLILIAYKVAENEKVLLPAMVGFDAFILTHTVEPVE
IPDQELVDEFLGEYEPKYAYLDPARPITQGTLAFPAHYMEARYTVWEANENARKVIDEAF
AEFEKKFGRKYQKIEEYRTEDAEIIFVTMGSLAGTVKEYVDHLREQGIKVGAAKMTVYRP
FPIEEVRALAKKAKVLALLEKNVTFSVGGALFQDFSRALINESEKPKIVDFILGLGGRDV
TFKDLDEALAIAQKALNGEAVDEVNWIGLRKEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccgataagaaaggttatgaaggccaacgaggctgccgcctgggcggccaagctcgcc
aagccgaaggtcatagcggcgttcccgattaccccgtcaacgctcgttccggagaagatc
agtgagttcgtcgccgacggagagctcgacgccgagttcatcaaggtcgagagcgagcac
tcggcgatttcagcctgtgtcggtgcatcagcggctggagtcagaaccttcaccgcgacc
gcttcccagggtctggcactcatgcacgagatactcttcatagccgcaggcatgaggctt
ccgatagtcatcgccgtcggaaaccgctccctgagcgctccgatcaacatctggaacgac
tggcaggacaccatcagcgagcgcgacaccggctggcttcagttctacgccgagaacaac
caggaggcccttgacctcatactcatcgcatacaaggtcgccgagaacgagaaggtcctt
cttccggcgatggttggattcgacgccttcatcctgacccacaccgttgagccggtcgag
ataccggaccaggagctcgtcgacgagttcctcggcgagtacgagccgaagtacgcctac
ctcgacccggccaggccgataacccagggcaccctcgccttcccggcccactacatggag
gccaggtacaccgtctgggaggccaacgagaacgccaggaaggtcatagacgaggcgttc
gcggagttcgagaagaagttcggcaggaagtaccagaagatagaggagtacaggaccgag
gacgccgagataatctttgtcaccatgggttcactcgccggaaccgttaaggagtacgtc
gaccacctccgcgagcagggcatcaaggtcggcgcggccaagatgaccgtttacagaccg
ttcccgatcgaggaggttcgcgcgctcgccaagaaggcgaaggttctcgcgctcctcgag
aagaatgtcaccttcagcgtcggtggagccctcttccaggacttcagcagggcgctcatc
aacgagagcgagaagccgaagatcgttgacttcatcctcggccttggaggaagggacgtc
accttcaaggacctcgacgaggccctcgcgattgcccagaaggccctcaacggagaggcc
gttgatgaggtcaactggatcggcctgaggaaggagattctgtga

DBGET integrated database retrieval system