KEGG   Thermococcus sp. 4557: GQS_08120Help
Entry
GQS_08120         CDS       T01588                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GQS_08120 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_08120 (porD)
   00020 Citrate cycle (TCA cycle)
    GQS_08120 (porD)
   00620 Pyruvate metabolism
    GQS_08120 (porD)
   00640 Propanoate metabolism
    GQS_08120 (porD)
   00650 Butanoate metabolism
    GQS_08120 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    GQS_08120 (porD)
   00680 Methane metabolism
    GQS_08120 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GQS_08120 (porD)
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GQS_08120 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1543146..1543463)
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIATIPGSSVINKTGSWRVFMPEFNRDKCVRCYLCY
IYCPEPAIYLDEENYPVFDYDYCKGCGVCANECPTDAIIMVRESK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggccgagagtccgtttaaggccgacatagagagggttcagaaggagtatagcgaaaag
atgacccctggagcgatagccaccatccctgggagcagcgtcataaacaagaccggttcc
tggcgtgttttcatgcccgagttcaaccgggacaagtgcgtccgctgctacctctgctac
atctactgcccggagccggctatctacctcgacgaggagaactacccggtcttcgactac
gactactgtaagggctgtggagtttgcgcgaacgagtgcccgaccgacgctatcataatg
gttagggagagcaagtga

DBGET integrated database retrieval system