KEGG   Thermococcus sp. 4557: GQS_08125Help
Entry
GQS_08125         CDS       T01588                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
the  Thermococcus sp. 4557
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GQS_08125
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     GQS_08125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1543525..1544460)
Genome map
AA seq 311 aa AA seqDB search
MEIPENVKKRLSIPADEHFYAGHTACQGCGASLGLRYVLKTYGKKTIFTIPACCSTIIAG
AWPYSTLDAPLFHTAFETTGAVMSGIEAALKVKGYKVKGEDGVMVVGWAGDGGTADIGLQ
ALSGFLERGHDALYIMYDNEAYMNTGIQRSGSTPYGAWTTNTPGGKKHFLEKRHKKKVID
IVIAHEIPYAATASVAYPEDFIRKLKKARDTPGPSFIQLFSPCPTGWRSPTDKSIELARL
AVQTAYFPLFEYENGKYKINMPSPKKEPKPIEEFLKYQGRFKYMTKEDIEILQQWVNHEW
EKLKKLAEIFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagattcccgagaacgttaagaagaggttgagcattccagctgatgagcacttttac
gcaggccacaccgcctgccagggatgtggcgcttccctgggtcttcgctacgtgctcaag
acctacggcaagaagaccatcttcacaatccccgcgtgctgttcgaccatcatagccggt
gcgtggccgtactcaaccctcgacgccccgctcttccacacggcctttgagaccaccggt
gcggttatgagcggtatcgaggcggccctcaaggtcaagggctacaaggttaaaggtgag
gacggcgtcatggtcgtcggctgggccggcgacggcggtaccgcggacataggtctccag
gccctcagcggattcctcgagaggggccacgacgcgctctacatcatgtacgacaacgag
gcctacatgaacaccggaatccagaggtccggttcgactccctacggtgcctggaccacc
aacacccctggcggaaagaagcacttcctcgagaagaggcacaagaagaaggtcatcgac
atcgtcatcgcccacgagataccctacgctgccaccgcaagcgtcgcctatccggaggac
ttcataaggaagctcaagaaggccagggacaccccgggaccgagcttcatacagctcttc
agtccatgcccaacgggctggcgctcaccgaccgacaagagcatcgagctcgcgaggctc
gccgttcagaccgcatacttcccgctcttcgagtacgagaacggaaagtacaagatcaac
atgccctcaccgaagaaggagccgaagccgatagaggagttcctcaagtaccagggcagg
ttcaagtacatgaccaaggaggacattgagatcctccagcagtgggtcaaccacgagtgg
gagaagctcaagaagctcgccgagatcttcggctga

DBGET integrated database retrieval system