KEGG   Thermococcus sp. 4557: GQS_08125Help
Entry
GQS_08125         CDS       T01588                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
the  Thermococcus sp. 4557
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:the00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1543525..1544460)
Genome map
AA seq 311 aa AA seqDB search
MEIPENVKKRLSIPADEHFYAGHTACQGCGASLGLRYVLKTYGKKTIFTIPACCSTIIAG
AWPYSTLDAPLFHTAFETTGAVMSGIEAALKVKGYKVKGEDGVMVVGWAGDGGTADIGLQ
ALSGFLERGHDALYIMYDNEAYMNTGIQRSGSTPYGAWTTNTPGGKKHFLEKRHKKKVID
IVIAHEIPYAATASVAYPEDFIRKLKKARDTPGPSFIQLFSPCPTGWRSPTDKSIELARL
AVQTAYFPLFEYENGKYKINMPSPKKEPKPIEEFLKYQGRFKYMTKEDIEILQQWVNHEW
EKLKKLAEIFG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagattcccgagaacgttaagaagaggttgagcattccagctgatgagcacttttac
gcaggccacaccgcctgccagggatgtggcgcttccctgggtcttcgctacgtgctcaag
acctacggcaagaagaccatcttcacaatccccgcgtgctgttcgaccatcatagccggt
gcgtggccgtactcaaccctcgacgccccgctcttccacacggcctttgagaccaccggt
gcggttatgagcggtatcgaggcggccctcaaggtcaagggctacaaggttaaaggtgag
gacggcgtcatggtcgtcggctgggccggcgacggcggtaccgcggacataggtctccag
gccctcagcggattcctcgagaggggccacgacgcgctctacatcatgtacgacaacgag
gcctacatgaacaccggaatccagaggtccggttcgactccctacggtgcctggaccacc
aacacccctggcggaaagaagcacttcctcgagaagaggcacaagaagaaggtcatcgac
atcgtcatcgcccacgagataccctacgctgccaccgcaagcgtcgcctatccggaggac
ttcataaggaagctcaagaaggccagggacaccccgggaccgagcttcatacagctcttc
agtccatgcccaacgggctggcgctcaccgaccgacaagagcatcgagctcgcgaggctc
gccgttcagaccgcatacttcccgctcttcgagtacgagaacggaaagtacaagatcaac
atgccctcaccgaagaaggagccgaagccgatagaggagttcctcaagtaccagggcagg
ttcaagtacatgaccaaggaggacattgagatcctccagcagtgggtcaaccacgagtgg
gagaagctcaagaagctcgccgagatcttcggctga

DBGET integrated database retrieval system