KEGG   Thermococcus sp. 4557: GQS_08140Help
Entry
GQS_08140         CDS       T01588                                 

Definition
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GQS_08140
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GQS_08140
   00020 Citrate cycle (TCA cycle)
    GQS_08140
   00620 Pyruvate metabolism
    GQS_08140
   00640 Propanoate metabolism
    GQS_08140
   00650 Butanoate metabolism
    GQS_08140
  Energy metabolism
   00680 Methane metabolism
    GQS_08140
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    GQS_08140
Enzymes [BR:the01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     GQS_08140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546024..1546581)
Genome map
AA seq 185 aa AA seqDB search
MIEIRFHGRGGQGAVTAANILASAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRI
KTQIYEPDIVVVLDPSLLDTVDVTAGLKDGGIVIINTEKSKEEVLEKLKKKPAKLALVDA
TTIALDVLGLPITNTSILGAVSKATGVVSLEHVQKAIQDVFSGALGEKNAKAAEEAFNKT
VIYEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagattcgttttcacggtagaggtggacagggtgccgttaccgctgccaacata
ctagcctcggctgctttccttgagggcaagtacgtccaggcgttcccgttcttcggtgtt
gagaggcgtggagcgccagttaccgctttcaccaggatcgacgagaagccgataaggatc
aagacccagatctacgagccggacatcgtggtcgtcctcgacccgagccttctcgacacc
gtcgatgtcaccgccggtctcaaggacggcggaatagtcatcatcaacacagagaagagc
aaggaggaagtccttgagaagctcaagaagaagccggccaagctcgcgctcgttgacgcc
accaccatagccctcgacgtccttggactgccgatcaccaacacctcgatcctcggtgcg
gtctccaaggccaccggtgtcgtcagcctcgagcacgtccagaaggccatccaggacgtc
ttctccggcgccctcggagagaagaacgccaaggccgcagaggaagcctttaacaagacc
gtcatctacgagctctga

DBGET integrated database retrieval system