KEGG   Thermococcus sp. 4557: GQS_08455Help
Entry
GQS_08455         CDS       T01588                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GQS_08455
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GQS_08455
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GQS_08455
Enzymes [BR:the01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GQS_08455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1599297..1600427)
Genome map
AA seq 376 aa AA seqDB search
MKLVCPICGKTYDEPVQRCECGEPVEFERFTGEPYIGKSVWERFWDFWPVEPALEFSLGE
GDTPLVKSRLGEELGVKLYLKNETVNPTWSFKDRGTFLAMSYALKAGYKTVGTVSTGNMA
ASVSAYASRFGLEAKILVSESASDEKLKAVSVYGSEVIRVHGDYGRLYFESLKLGERLGV
YFMNSDNPFRIEGYKGIAFEIAEEISPDYVLIPTSSGGLFRGIAKGFIELHESGLIDDLP
TLIAVQAEGCSPICRAFKEGREKIKRFENPKTIAKAIANPYPPSGNAVLRLMRDFGWSCV
SVSDGEILEAQRKLAGEGLFVQPASATGIAALERLDLPSGAKVVSILTGSGLRTLKDAPT
GKIEECPLGMLESCLR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctggtctgccccatctgtggaaagacctacgacgaaccggttcagaggtgtgaa
tgcggcgagccggtcgagtttgaaaggttcacgggcgagccgtacataggaaagagcgtc
tgggagcggttctgggacttctggccggtggagcctgctctggagttctccctcggcgag
ggagacacgccccttgtgaagtcgaggctcggcgaagagcttggagtgaagctctacctc
aagaacgagacagtaaacccgacgtggagcttcaaggacaggggcacttttctggcgatg
agctacgccctaaaggccggctacaaaaccgttggaaccgtctccacaggaaatatggcg
gcgagcgtttcggcctacgcttcccgctttggattagaggccaaaatcctcgtctccgag
agcgcgagcgacgagaagctgaaggccgtttcggtttacggcagcgaggtcatcagggtt
cacggcgactacgggagactctacttcgagagcctgaagttgggagaaaggctcggggtc
tacttcatgaactcggacaaccccttcagaatcgagggctacaagggcatagccttcgag
atagccgaggagataagcccggactacgttctaattccaaccagctcgggcgggctcttc
cggggaatagccaaaggcttcatcgagctccacgagagcgggctcatcgatgacctcccc
accctcatagcggttcaggcggagggctgttcgccgatatgcagggcttttaaggagggc
agggagaagatcaagcgctttgaaaatcccaagaccatagctaaggccatagccaacccg
tatccgccgagcgggaacgcggttctaaggctcatgcgggacttcggctggagctgtgta
tccgtttccgacggtgagatactcgaagctcagaggaagctcgccggcgaaggcctcttc
gtccaaccggcgagtgcgacaggcatagcggcgctggagaggctcgaccttccaagcggt
gccaaagtcgtctccatcctcaccggctcgggcttgagaacgctgaaggacgcgccaact
ggaaaaatagaggagtgcccgctcgggatgctggaaagctgtttgaggtga

DBGET integrated database retrieval system