KEGG   Thermococcus sp. 4557: GQS_08455Help
Entry
GQS_08455         CDS       T01588                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
the  Thermococcus sp. 4557
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:the01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:the00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:the00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1599297..1600427)
Genome map
AA seq 376 aa AA seqDB search
MKLVCPICGKTYDEPVQRCECGEPVEFERFTGEPYIGKSVWERFWDFWPVEPALEFSLGE
GDTPLVKSRLGEELGVKLYLKNETVNPTWSFKDRGTFLAMSYALKAGYKTVGTVSTGNMA
ASVSAYASRFGLEAKILVSESASDEKLKAVSVYGSEVIRVHGDYGRLYFESLKLGERLGV
YFMNSDNPFRIEGYKGIAFEIAEEISPDYVLIPTSSGGLFRGIAKGFIELHESGLIDDLP
TLIAVQAEGCSPICRAFKEGREKIKRFENPKTIAKAIANPYPPSGNAVLRLMRDFGWSCV
SVSDGEILEAQRKLAGEGLFVQPASATGIAALERLDLPSGAKVVSILTGSGLRTLKDAPT
GKIEECPLGMLESCLR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctggtctgccccatctgtggaaagacctacgacgaaccggttcagaggtgtgaa
tgcggcgagccggtcgagtttgaaaggttcacgggcgagccgtacataggaaagagcgtc
tgggagcggttctgggacttctggccggtggagcctgctctggagttctccctcggcgag
ggagacacgccccttgtgaagtcgaggctcggcgaagagcttggagtgaagctctacctc
aagaacgagacagtaaacccgacgtggagcttcaaggacaggggcacttttctggcgatg
agctacgccctaaaggccggctacaaaaccgttggaaccgtctccacaggaaatatggcg
gcgagcgtttcggcctacgcttcccgctttggattagaggccaaaatcctcgtctccgag
agcgcgagcgacgagaagctgaaggccgtttcggtttacggcagcgaggtcatcagggtt
cacggcgactacgggagactctacttcgagagcctgaagttgggagaaaggctcggggtc
tacttcatgaactcggacaaccccttcagaatcgagggctacaagggcatagccttcgag
atagccgaggagataagcccggactacgttctaattccaaccagctcgggcgggctcttc
cggggaatagccaaaggcttcatcgagctccacgagagcgggctcatcgatgacctcccc
accctcatagcggttcaggcggagggctgttcgccgatatgcagggcttttaaggagggc
agggagaagatcaagcgctttgaaaatcccaagaccatagctaaggccatagccaacccg
tatccgccgagcgggaacgcggttctaaggctcatgcgggacttcggctggagctgtgta
tccgtttccgacggtgagatactcgaagctcagaggaagctcgccggcgaaggcctcttc
gtccaaccggcgagtgcgacaggcatagcggcgctggagaggctcgaccttccaagcggt
gccaaagtcgtctccatcctcaccggctcgggcttgagaacgctgaaggacgcgccaact
ggaaaaatagaggagtgcccgctcgggatgctggaaagctgtttgaggtga

DBGET integrated database retrieval system