KEGG   Thermococcus sp. 4557: GQS_10255Help
Entry
GQS_10255         CDS       T01588                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
the  Thermococcus sp. 4557
Brite
Enzymes [BR:the01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     GQS_10255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1923943..1925454)
Genome map
AA seq 503 aa AA seqDB search
MKAKVRILDVYSGRYSVFINEKEAMRAKLHPDDLVKLEAGKKTVYGSVVISGLVREGEIG
ISRDILQLHSFSEGETVTVIPSGTPESVRYIKKKMNGGKLRKVEIETIIKDIVDRKLRDI
EISSFVTSLEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVFADVSFSLDEIKRIVEKIGACMVWGGALNLA
PADDITIKSERALSIDPTGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVESVDQARALAR
DFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALQALMAGTGPGSLIEKATGLAGV
LLEMGGVAPAGMGKKMAREILESGKAYQKMREIIEEQGGNPDIKPEDIPVGDKTYTFTAP
TSGYITAIDNKAITGIARAAGAPEDKGAGIELYVKVGEKVKEGDPLFTIHAESEARLDQA
IVFARRTEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggctaaggtcaggatactggatgtgtacagcgggaggtactcggttttcataaac
gagaaggaggccatgagggccaagcttcacccggatgatcttgtaaagcttgaggcgggc
aagaagacggtttacggcagcgtggtcataagcggtcttgtcagggagggagagattgga
ataagcagggacatccttcagctccacagcttctccgagggtgagaccgttactgtcatc
ccgagcggcacaccagagagcgtccgctacataaagaagaagatgaacggaggaaagctc
cggaaggtggagatagagacgataatcaaggacatcgttgacaggaagctccgcgacatt
gagataagctcattcgtcacctcgcttgagataaacggcctcgatatggacgagatagcc
gccctgacgatagcaatggccgagacgggcgacatgctcgacatagacagaaagccgata
atggacgtccacagcattggaggcgtccccggcaacaagacaaacatcctcgtcgtgccc
atcgttgccgccgccggcctcaccatccccaagaccagttcccgtgcaataaccagcgcg
gccggaacggcggacgtcgtggaggtctttgcggacgtcagcttctccctcgatgagata
aagcgcatcgtggagaagataggggcctgtatggtctggggaggagcgcttaacctcgcc
ccggccgacgacataaccatcaaatctgagcgcgccctcagcatcgacccgaccggcctg
atgctggccagcataatgtcaaagaagtacgccatgggtagccagtacgtcctcatcgac
attcccaccggcaagggcgtcaaggtcgagagtgtggaccaggccagggccctggcgagg
gacttcattgagctgggcaagaggctcggtcagtacgtcgaggtggccataacctacggc
ggccagccgattggacacaccgtcggcccggccctcgaggcgagggaggccctccaggcc
ctcatggccggcaccggtccgggcagtcttatagagaaggccaccgggctcgccggagtc
ctgctggagatgggcggtgttgcaccggccggaatgggcaagaagatggcgcgcgagata
ctcgagagcggaaaggcataccagaagatgcgcgagataatagaggagcagggaggcaac
ccggacatcaagccggaggacatccctgttggcgacaagacctacacattcaccgcaccg
acgagcggctacatcaccgccatagacaacaaggccatcacgggaatagccagggccgcc
ggggcgccggaggacaaaggcgcgggaatcgagctgtacgtcaaggttggggagaaggtc
aaggagggcgacccgctcttcacgatccacgcggagagcgaggccaggctcgaccaggcg
atagtctttgcaaggaggacagagcccataagaatagaagggatggtccttcagaggata
ggcaacatctga

DBGET integrated database retrieval system