KEGG   Thermogladius cellulolyticus: TCELL_0205Help
Entry
TCELL_0205        CDS       T02127                                 

Definition
Pyridoxal-5'-phosphate-dependent enzyme, beta subunit
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TCELL_0205
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCELL_0205
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TCELL_0205
Enzymes [BR:thg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TCELL_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196131..197213
Genome map
AA seq 360 aa AA seqDB search
METGFSWFCPKCGFREEFGKSYYYKCPKCGGPLTISTSKRYELSEGKGLYKFKSVLPVLP
YKYTGEGGTPLVEVVEEGVNVWFKLEYTNPSGSFKDRGTSLSLAYAKRLGYTKVVDDSSG
NTAISISLYSRVLGLKPVLFVPKTAPEGKKRALRFLGATLYESESRGAASVDVVKYVERN
PGTYYVAHTWSYFYVLGAATISFEVFEEAGVPDYVIAPIGSGGLLLGLTHGFKTLLEQGL
TTKMPRVIGVQGYSAQPVSVALKGVETPGEDSSLADGIMVPNPPRLGEIVEAIKETGGDV
YLVGNSEIREAWSKLIDQGFLVEPTSAAAYAVLQKLKSRLQGKTVLIPLTGSGLKIISQA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggagacgggcttctcctggttttgtcccaagtgcggttttagagaggagtttggcaag
tcctactactacaagtgcccgaagtgtggaggccccctgacgatctctactagcaagaga
tacgagttgtccgagggtaagggcctctacaagttcaagagcgttctccccgtcctcccg
tacaagtacaccggtgaggggggtacacccctagtcgaggtcgttgaggaaggggtaaac
gtgtggtttaaactcgaatacacgaaccctagcggtagcttcaaggacaggggtacgagc
ctatccctcgcatacgctaagaggctggggtacacgaaggtcgttgacgactcctccggt
aacaccgctatatccatatcgctctactcccgtgtactcgggctaaagcccgtcctcttc
gtgcccaagaccgcgcctgagggcaagaagagggctctcaggttcctcggggccacgctc
tacgagtcggagagtaggggggccgcgagcgtggacgtggttaagtacgttgagagaaac
cccggcacgtactacgtggctcacacctggagctacttctacgtgttaggtgccgccacc
atctccttcgaggtattcgaggaggctggggtaccggactacgtgatagcccccataggc
tcggggggcctactactagggctgacacacggcttcaagacgctcctcgaacaaggcctg
acgaccaagatgcccagggtgataggcgtacagggctacagcgcccaaccagtcagcgta
gctctcaagggtgtcgagacgcccggagaggactccagcctagccgacggcataatggtc
cccaaccctcccaggcttggcgagatcgtagaagcgatcaaggagacgggtggagacgtc
tacctggtgggcaacagcgaaatcagggaggcgtggtctaagctaatagaccagggcttc
ctcgtagagccgacctcggcagccgcgtacgcagtactccagaagctgaagagcaggctc
cagggcaagacagtgctgatacccctcaccggctcggggctgaagataatatcgcaggcc
tag

DBGET integrated database retrieval system