KEGG   Thermogladius cellulolyticus 1633: TCELL_0263Help
Entry
TCELL_0263        CDS       T02127                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thg  Thermogladius cellulolyticus 1633
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:thg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:thg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:thg00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:thg00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:thg00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255266..255877)
Genome map
AA seq 203 aa AA seqDB search
MKELGGGVEIVLAPPYTEIRRVVEEVTGSGVRVFAQHADPVEPGAVTGFMPLEGLKEAGV
SGVILNHSEHRLKLADINSLVKKAAKLGLETLVCADEPETGAAVAALEPNYVAVEPPELI
GTGISVSKAKPEVIIRSVELIRRVNSRVVILTGAGITDGQDVYSAIRYGTSGVLVASAIV
KAKDPYSVIRDMAVSALKAVTGQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactgggcggtggagtcgagatcgttctggccccgccctacactgaaatacgg
agggtcgtcgaagaggtaacagggtctggtgttagggtcttcgcacaacacgccgacccc
gtggagcctggagctgttacgggtttcatgccgctcgagggtctcaaagaggcgggtgtg
agcggagtcatacttaaccacagcgagcacaggctcaaacttgcggacatcaactcactg
gtcaagaaggccgctaagctcgggctggagacgcttgtctgcgccgacgagcccgagacg
ggcgctgccgtggccgctctcgaacccaactacgtcgctgtcgagccacctgagcttata
ggcacgggtattagtgtgagtaaggctaaaccagaagtcattattaggagtgttgaactc
atcaggagagtcaatagtagagtagtgatcttgacgggcgccggcataacggacgggcaa
gacgtgtactcggctataaggtacgggacgagcggcgttctagtcgcgtcggcgatcgtg
aaggcgaaagacccctactcagttataagggacatggctgtaagcgctcttaaagccgtc
accggccagtag

DBGET integrated database retrieval system