KEGG   Thermogladius cellulolyticus: TCELL_0263Help
Entry
TCELL_0263        CDS       T02127                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_0263
   01230 Biosynthesis of amino acids
    TCELL_0263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0263
   00051 Fructose and mannose metabolism
    TCELL_0263
   00562 Inositol phosphate metabolism
    TCELL_0263
Enzymes [BR:thg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TCELL_0263
Exosome [BR:thg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TCELL_0263
  Exosomal proteins of bladder cancer cells
   TCELL_0263
  Exosomal proteins of melanoma cells
   TCELL_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255266..255877)
Genome map
AA seq 203 aa AA seqDB search
MKELGGGVEIVLAPPYTEIRRVVEEVTGSGVRVFAQHADPVEPGAVTGFMPLEGLKEAGV
SGVILNHSEHRLKLADINSLVKKAAKLGLETLVCADEPETGAAVAALEPNYVAVEPPELI
GTGISVSKAKPEVIIRSVELIRRVNSRVVILTGAGITDGQDVYSAIRYGTSGVLVASAIV
KAKDPYSVIRDMAVSALKAVTGQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaactgggcggtggagtcgagatcgttctggccccgccctacactgaaatacgg
agggtcgtcgaagaggtaacagggtctggtgttagggtcttcgcacaacacgccgacccc
gtggagcctggagctgttacgggtttcatgccgctcgagggtctcaaagaggcgggtgtg
agcggagtcatacttaaccacagcgagcacaggctcaaacttgcggacatcaactcactg
gtcaagaaggccgctaagctcgggctggagacgcttgtctgcgccgacgagcccgagacg
ggcgctgccgtggccgctctcgaacccaactacgtcgctgtcgagccacctgagcttata
ggcacgggtattagtgtgagtaaggctaaaccagaagtcattattaggagtgttgaactc
atcaggagagtcaatagtagagtagtgatcttgacgggcgccggcataacggacgggcaa
gacgtgtactcggctataaggtacgggacgagcggcgttctagtcgcgtcggcgatcgtg
aaggcgaaagacccctactcagttataagggacatggctgtaagcgctcttaaagccgtc
accggccagtag

DBGET integrated database retrieval system