KEGG   Thermogladius cellulolyticus: TCELL_0309Help
Entry
TCELL_0309        CDS       T02127                                 

Definition
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_0309
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0309
   00020 Citrate cycle (TCA cycle)
    TCELL_0309
   00620 Pyruvate metabolism
    TCELL_0309
   00640 Propanoate metabolism
    TCELL_0309
   00650 Butanoate metabolism
    TCELL_0309
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TCELL_0309
   00680 Methane metabolism
    TCELL_0309
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TCELL_0309
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TCELL_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297365..298561
Genome map
AA seq 398 aa AA seqDB search
MRTVGLKLVLTGNYALAYAAKVARVNVVAAYPITPQTSVVEKLAEFIEEGELDAVMIRVE
SEHSALAACFGAALAGARVFTATSSQGLLYMHEVVHWASRARAPIVMGIVTRTLGPPWNI
WPDHTDYMDQRDTGWIMSFAMDNQEAFDLTLQAFKVSEDPRVYLPVMVGIEGFILGHTSM
PVEIPEQNLVDEWLGPRRQPYVVDGSEYMAIGNLALPEDTEEFFMDIQNAMEEARKVVVE
VEEEYSKITGRPFKGPVECFKCEDAKYVAISMGAWSGDLMESVSQLRDEGYSVGLLRIRY
YRPFPGDYIFEKANSTKGVLVFDRAISFGSYGPIFLDTAASFLKHTRKTPYIKNVVAGIG
GVNITSDDFSRILKRFVHEVESDGVNVFEWYHKGKVVR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccgtggggttgaaactagtcttaacaggcaactacgccttggcgtacgcggcc
aaagttgctagagtaaacgtcgtggcagcctaccctatcacgcctcagacgagcgtggta
gagaagttggcagagttcatagaggagggcgagctagacgccgtaatgataagggtcgag
tcggagcactcagcactagccgcctgtttcggggcggcccttgccggggcgagggtattt
acagccacgagtagtcagggactcttgtacatgcacgaggtggtccactgggcttcgagg
gcccgcgcccccattgtcatgggtattgttacgaggacactaggccccccgtggaacatt
tggcccgaccacacggactacatggatcagagggacacaggctggattatgagcttcgcg
atggataatcaggaagccttcgacttaacgttgcaggctttcaaggtcagtgaagatcct
agagtctacttgccggtcatggtcgggattgaggggtttatactgggccacacctccatg
ccggtcgagataccggagcaaaacttggttgacgagtggctcgggcccaggaggcaaccg
tacgttgtggacggcagtgagtacatggcaataggcaacctcgccctgccggaggacacc
gaggagttctttatggacatacagaacgccatggaggaggctaggaaagtcgtagtggag
gtagaagaggagtattctaagatcaccgggaggcccttcaaagggcctgtggagtgcttt
aagtgcgaggacgccaagtacgtcgctatcagtatgggagcctggtcaggggacttgatg
gagtccgtatcacagttgcgcgacgaggggtacagcgtcggtctgctgaggatcaggtac
tacaggcccttccctggcgactatatattcgagaaggctaactcgacgaaaggcgtcttg
gtgttcgatagggccattagcttcgggtcttacggcccgatcttcctagacactgctgcc
tcattcttaaaacacacgagaaaaaccccctacattaagaatgtggtcgctgggatcggc
ggtgtcaatataacgtcggacgatttctcaaggatattgaagaggtttgtccacgaagtg
gagtctgacggcgtaaatgtattcgagtggtaccacaagggtaaggtggtcagatga

DBGET integrated database retrieval system