KEGG   Thermogladius cellulolyticus: TCELL_0310Help
Entry
TCELL_0310        CDS       T02127                                 

Definition
pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
thg  Thermogladius cellulolyticus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_0310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0310
   00020 Citrate cycle (TCA cycle)
    TCELL_0310
   00620 Pyruvate metabolism
    TCELL_0310
   00640 Propanoate metabolism
    TCELL_0310
   00650 Butanoate metabolism
    TCELL_0310
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TCELL_0310
   00680 Methane metabolism
    TCELL_0310
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TCELL_0310
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TCELL_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298558..299451
Genome map
AA seq 297 aa AA seqDB search
MSRPPLPYKTRDVVLPGDAACPGCPIPIAWKVLSAVFGDKMILVIPASCSSVVVGMYPGN
SLRASVIHVPFASAAAVASGVSEALKKRGVTDVQVIAWAGDGGTADIGMASLSGAAERNH
DFIYIMYDNEAYMNTGIQRSSSTPRGAWTTTTPIIGKSEEKKDVAKIMIAHGVPYVATAS
VGYVHDFYNKLVRASKIRGFRFISLHAPCPIGWRFDPRYTVKIARLAVESGLWVLYEYYD
GKIHLSGPSRPYVDPSKRKPVEEYLKLQGRFRRIDDELLKSIQEYVEKNWEWVKKHM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggccacccttgccctacaagaccagagacgtagtgttgccgggcgacgcggcc
tgtccggggtgccctataccgatagcgtggaaggttctctccgcggtgttcggagataag
atgatactcgttataccagcgagctgctcgtcggtcgtcgtagggatgtaccccggtaac
tccttgagggccagcgtgatacacgtaccattcgcttctgcagcggcagtagcctcgggc
gtttcggaggccctcaaaaagcggggtgttacggacgtccaggtcatagcctgggccggc
gacggcggtacagctgacatagggatggcatccttgagcggtgcggccgagcgtaaccac
gactttatatacataatgtacgacaacgaggcttacatgaacacgggtatccagaggagt
tcctcgacgcctagaggggcgtggacaacaactacaccaataatagggaagagcgaggag
aagaaggacgtggccaagatcatgatagcgcacggcgtgccatacgtggctacagctagc
gtaggctacgtccacgacttctacaacaagcttgttagggccagtaaaatcaggggcttc
aggttcataagtctgcacgctccatgcccgatagggtggaggttcgacccgaggtatact
gtcaagatcgcgaggctggctgtagagtcagggctctgggtactctacgagtactacgat
ggaaagatccacctttcgggcccgagcagaccttacgtggacccgtcgaagaggaagcct
gtcgaggagtacttaaagttgcagggcaggtttaggaggatcgacgacgaattactaaag
agtatacaggagtacgtggagaagaactgggagtgggtcaagaagcacatgtga

DBGET integrated database retrieval system