KEGG   Thermogladius calderae: TCELL_0310Help
Entry
TCELL_0310        CDS       T02127                                 

Definition
(GenBank) pyruvate/ketoisovalerate ferredoxin oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
thg  Thermogladius calderae
Pathway
thg00010  Glycolysis / Gluconeogenesis
thg00020  Citrate cycle (TCA cycle)
thg00620  Pyruvate metabolism
thg00640  Propanoate metabolism
thg00650  Butanoate metabolism
thg00680  Methane metabolism
thg00720  Carbon fixation pathways in prokaryotes
thg01100  Metabolic pathways
thg01120  Microbial metabolism in diverse environments
thg01130  Biosynthesis of antibiotics
thg01200  Carbon metabolism
Module
thg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TCELL_0310
   00020 Citrate cycle (TCA cycle)
    TCELL_0310
   00620 Pyruvate metabolism
    TCELL_0310
   00640 Propanoate metabolism
    TCELL_0310
   00650 Butanoate metabolism
    TCELL_0310
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TCELL_0310
   00680 Methane metabolism
    TCELL_0310
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TCELL_0310
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TCELL_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AFK50735
UniProt: I3TD97
Position
298558..299451
Genome map
AA seq 297 aa AA seqDB search
MSRPPLPYKTRDVVLPGDAACPGCPIPIAWKVLSAVFGDKMILVIPASCSSVVVGMYPGN
SLRASVIHVPFASAAAVASGVSEALKKRGVTDVQVIAWAGDGGTADIGMASLSGAAERNH
DFIYIMYDNEAYMNTGIQRSSSTPRGAWTTTTPIIGKSEEKKDVAKIMIAHGVPYVATAS
VGYVHDFYNKLVRASKIRGFRFISLHAPCPIGWRFDPRYTVKIARLAVESGLWVLYEYYD
GKIHLSGPSRPYVDPSKRKPVEEYLKLQGRFRRIDDELLKSIQEYVEKNWEWVKKHM
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggccacccttgccctacaagaccagagacgtagtgttgccgggcgacgcggcc
tgtccggggtgccctataccgatagcgtggaaggttctctccgcggtgttcggagataag
atgatactcgttataccagcgagctgctcgtcggtcgtcgtagggatgtaccccggtaac
tccttgagggccagcgtgatacacgtaccattcgcttctgcagcggcagtagcctcgggc
gtttcggaggccctcaaaaagcggggtgttacggacgtccaggtcatagcctgggccggc
gacggcggtacagctgacatagggatggcatccttgagcggtgcggccgagcgtaaccac
gactttatatacataatgtacgacaacgaggcttacatgaacacgggtatccagaggagt
tcctcgacgcctagaggggcgtggacaacaactacaccaataatagggaagagcgaggag
aagaaggacgtggccaagatcatgatagcgcacggcgtgccatacgtggctacagctagc
gtaggctacgtccacgacttctacaacaagcttgttagggccagtaaaatcaggggcttc
aggttcataagtctgcacgctccatgcccgatagggtggaggttcgacccgaggtatact
gtcaagatcgcgaggctggctgtagagtcagggctctgggtactctacgagtactacgat
ggaaagatccacctttcgggcccgagcagaccttacgtggacccgtcgaagaggaagcct
gtcgaggagtacttaaagttgcagggcaggtttaggaggatcgacgacgaattactaaag
agtatacaggagtacgtggagaagaactgggagtgggtcaagaagcacatgtga

DBGET integrated database retrieval system