KEGG   Thermogladius cellulolyticus: TCELL_0586Help
Entry
TCELL_0586        CDS       T02127                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thg  Thermogladius cellulolyticus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TCELL_0586
Enzymes [BR:thg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TCELL_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531238..531840
Genome map
AA seq 200 aa AA seqDB search
MTFSEEGELGKLVLAMRELFQLGLINPRGGNGSVLLDERHIAITPSGVAKQWLKVEDLVI
YDMEKGESRGRFKPSIEVNAHVLTYKKVKDAKAVLHAHPPLVLALTERFTKSRSRRRWWE
TGLVEVEYSIGKAEVAEPFQPGSMELAEEVSSKLASGARVVIVPKHGVFAWGRTVEEAMD
AIVALELVAKYTLAWLFLVK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgacctttagcgaggagggcgagctgggaaaactagtactcgctatgcgcgagcttttc
cagctaggactaataaaccctagaggagggaacggcagtgtcctcctggacgagaggcac
atagccatcacgccatcaggtgtcgctaagcagtggctcaaggttgaagacctggtaatt
tacgacatggaaaaaggcgagtctcgagggaggttcaagccctcgatcgaggtcaacgcc
catgtcttgacatacaaaaaggtcaaggatgcgaaagcagtactccacgctcaccccccg
ttagttcttgctttaacggaacgcttcacgaagtccaggtcgcggagaaggtggtgggag
acaggtctagtggaagtggagtacagcatcggcaaagcagaggtcgccgagccgttccag
cccgggagcatggagttggcagaggaagtctcgagcaagcttgcctctggggcgcgggtc
gttatcgtccctaagcacggcgtctttgcgtgggggcggacagtcgaagaggcgatggac
gccatagtggccttggagctcgtagccaagtatactctcgcgtggctcttcttagtaaag
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system