KEGG   Thermogladius cellulolyticus 1633: TCELL_0586Help
Entry
TCELL_0586        CDS       T02127                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
thg  Thermogladius cellulolyticus 1633
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:thg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531238..531840
Genome map
AA seq 200 aa AA seqDB search
MTFSEEGELGKLVLAMRELFQLGLINPRGGNGSVLLDERHIAITPSGVAKQWLKVEDLVI
YDMEKGESRGRFKPSIEVNAHVLTYKKVKDAKAVLHAHPPLVLALTERFTKSRSRRRWWE
TGLVEVEYSIGKAEVAEPFQPGSMELAEEVSSKLASGARVVIVPKHGVFAWGRTVEEAMD
AIVALELVAKYTLAWLFLVK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgacctttagcgaggagggcgagctgggaaaactagtactcgctatgcgcgagcttttc
cagctaggactaataaaccctagaggagggaacggcagtgtcctcctggacgagaggcac
atagccatcacgccatcaggtgtcgctaagcagtggctcaaggttgaagacctggtaatt
tacgacatggaaaaaggcgagtctcgagggaggttcaagccctcgatcgaggtcaacgcc
catgtcttgacatacaaaaaggtcaaggatgcgaaagcagtactccacgctcaccccccg
ttagttcttgctttaacggaacgcttcacgaagtccaggtcgcggagaaggtggtgggag
acaggtctagtggaagtggagtacagcatcggcaaagcagaggtcgccgagccgttccag
cccgggagcatggagttggcagaggaagtctcgagcaagcttgcctctggggcgcgggtc
gttatcgtccctaagcacggcgtctttgcgtgggggcggacagtcgaagaggcgatggac
gccatagtggccttggagctcgtagccaagtatactctcgcgtggctcttcttagtaaag
tag

DBGET integrated database retrieval system