KEGG   Thermogladius cellulolyticus 1633: TCELL_0599Help
Entry
TCELL_0599        CDS       T02127                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thg  Thermogladius cellulolyticus 1633
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:thg01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:thg00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544001..545827
Genome map
AA seq 608 aa AA seqDB search
MEGWWGRLLRVDLSRGKTSIVDVDKKILLDYMGGRGLAIRLLWDFNPPGVDPLSPYNTLV
IASGPLSGLPLPSSGKLVVTSKSPLTNGYGDGNIGSMASHHLKRAGFDAIVIQGKAKKPV
YLYIENDKVSINPADDLWGLDSFGVEDKLVREHGKNVGILTIGPAGEKMVRYATVVSQKG
RSGGRPGIGAVMGSKNLKAVVIKGTLQPPVHDIESLRKTAEEAYKKIMEAEGYDYWVRQG
TMATIVWSQQNSVLPTMNFREGVWEEYEGISGDLMEKLKVERRACPYCNMGCGNVIKDEL
DELSELDYENVAMLGSNILLGDLRKVADINKLADKYGLDTISLGNSIGFLMEASEKGLVR
ERVEWGDYKVVRELTEDVAFRRGLGGFLAEGVMRMSTALGGEALEFAMHVKGLEISAYDC
HAAPAMALAYGTSPIGAHHKDAWIISYEVRTDRLGYTREKVERLVYLQDVRGGMFESLTV
CRLPWVELGLDLDYYLKMLSHVTGIEWSWGMIREVANRIYTLIRAFWIREFDGWSKYYDY
PPARWFKHPLTKGPYKGVKLDPAKYEQMLQEYYALRGWDSNGVPKPETLSKLGLTFVEDT
LKRVGVLV
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
gtggaagggtggtggggccggcttctgagagtagacctctctagggggaagaccagcatc
gtagatgtcgacaaaaagattctcctagactacatgggtggtagagggctcgcgataagg
ctcctgtgggatttcaaccccccaggagtggatcccctctctccttacaacacgctagtg
atagcctcgggtcccttgtccgggttacctctccctagtagtggtaagctggtggtgacc
tccaagagcccgctgacgaacggctacggtgacggaaacatcggtagcatggcgagccac
cacctcaagagggctggtttcgacgcaatcgtgatccagggcaaggctaagaagcctgtc
tacctttacattgagaacgataaggtgagtataaaccccgcagacgacctatggggccta
gactcgttcggcgtggaagacaaactagtcagagagcacgggaagaacgttggtatcttg
acgataggacctgccggagagaagatggtgaggtacgctactgttgtctcccagaagggg
aggagcggtggacgtcccgggataggtgctgtgatgggcagtaagaacttaaaggccgtt
gtgataaagggtactctccagcctcccgtccacgacatagaatctctgagaaaaacggcc
gaggaggcttacaagaagatcatggaggcagagggctacgactactgggtaaggcagggg
acgatggcgacaatagtgtggagccagcaaaacagcgtactaccgactatgaacttcaga
gaaggcgtgtgggaggagtacgagggcatatcaggggacttgatggagaagcttaaagtc
gagaggcgggcctgcccctactgcaacatgggttgcggaaacgtgataaaggacgagctc
gacgagctcagcgagctggactacgagaacgtggcgatgctgggtagcaacatactgttg
ggcgacctgaggaaggtggcggacataaacaagctcgccgacaagtacggtctcgacacg
atctcgctggggaactcgattggattcctcatggaggccagcgagaagggcctagtgagg
gagagggtcgagtggggcgactacaaagtggtgagagagctcaccgaggacgtggctttt
aggcgtggcttgggcgggttcctcgcagagggcgtaatgaggatgagtacggcactcgga
ggcgaggcgctcgagttcgcaatgcacgttaaaggcctcgagatatcggcctacgactgc
cacgcagccccagcgatggcgctcgcatacggcacctcgcctataggtgctcatcacaag
gacgcctggatcataagctacgaggtcaggacggataggctcggatacacgagggagaaa
gtcgagaggcttgtgtaccttcaggacgtgagaggagggatgttcgagtctttaaccgtg
tgtaggctcccgtgggtggagttagggctagacctcgactactacttgaagatgctgagc
cacgtcacgggtatcgagtggagctggggcatgatacgcgaggtcgcaaacaggatctac
acgttgataagggccttctggataagggagttcgacgggtggagcaagtactacgactac
ccgccggctaggtggttcaaacacccgttgactaagggcccgtacaagggtgtcaagcta
gaccctgcgaagtacgagcagatgctccaggagtactacgctctgaggggctgggacagc
aacggcgtaccgaagcccgagaccctcagtaagctcggactcacgttcgtcgaagacacg
ttgaagagagttggagtactggtatga

DBGET integrated database retrieval system