KEGG   Thermogladius cellulolyticus: TCELL_0599Help
Entry
TCELL_0599        CDS       T02127                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
thg  Thermogladius cellulolyticus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TCELL_0599
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TCELL_0599
Enzymes [BR:thg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     TCELL_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544001..545827
Genome map
AA seq 608 aa AA seqDB search
MEGWWGRLLRVDLSRGKTSIVDVDKKILLDYMGGRGLAIRLLWDFNPPGVDPLSPYNTLV
IASGPLSGLPLPSSGKLVVTSKSPLTNGYGDGNIGSMASHHLKRAGFDAIVIQGKAKKPV
YLYIENDKVSINPADDLWGLDSFGVEDKLVREHGKNVGILTIGPAGEKMVRYATVVSQKG
RSGGRPGIGAVMGSKNLKAVVIKGTLQPPVHDIESLRKTAEEAYKKIMEAEGYDYWVRQG
TMATIVWSQQNSVLPTMNFREGVWEEYEGISGDLMEKLKVERRACPYCNMGCGNVIKDEL
DELSELDYENVAMLGSNILLGDLRKVADINKLADKYGLDTISLGNSIGFLMEASEKGLVR
ERVEWGDYKVVRELTEDVAFRRGLGGFLAEGVMRMSTALGGEALEFAMHVKGLEISAYDC
HAAPAMALAYGTSPIGAHHKDAWIISYEVRTDRLGYTREKVERLVYLQDVRGGMFESLTV
CRLPWVELGLDLDYYLKMLSHVTGIEWSWGMIREVANRIYTLIRAFWIREFDGWSKYYDY
PPARWFKHPLTKGPYKGVKLDPAKYEQMLQEYYALRGWDSNGVPKPETLSKLGLTFVEDT
LKRVGVLV
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
gtggaagggtggtggggccggcttctgagagtagacctctctagggggaagaccagcatc
gtagatgtcgacaaaaagattctcctagactacatgggtggtagagggctcgcgataagg
ctcctgtgggatttcaaccccccaggagtggatcccctctctccttacaacacgctagtg
atagcctcgggtcccttgtccgggttacctctccctagtagtggtaagctggtggtgacc
tccaagagcccgctgacgaacggctacggtgacggaaacatcggtagcatggcgagccac
cacctcaagagggctggtttcgacgcaatcgtgatccagggcaaggctaagaagcctgtc
tacctttacattgagaacgataaggtgagtataaaccccgcagacgacctatggggccta
gactcgttcggcgtggaagacaaactagtcagagagcacgggaagaacgttggtatcttg
acgataggacctgccggagagaagatggtgaggtacgctactgttgtctcccagaagggg
aggagcggtggacgtcccgggataggtgctgtgatgggcagtaagaacttaaaggccgtt
gtgataaagggtactctccagcctcccgtccacgacatagaatctctgagaaaaacggcc
gaggaggcttacaagaagatcatggaggcagagggctacgactactgggtaaggcagggg
acgatggcgacaatagtgtggagccagcaaaacagcgtactaccgactatgaacttcaga
gaaggcgtgtgggaggagtacgagggcatatcaggggacttgatggagaagcttaaagtc
gagaggcgggcctgcccctactgcaacatgggttgcggaaacgtgataaaggacgagctc
gacgagctcagcgagctggactacgagaacgtggcgatgctgggtagcaacatactgttg
ggcgacctgaggaaggtggcggacataaacaagctcgccgacaagtacggtctcgacacg
atctcgctggggaactcgattggattcctcatggaggccagcgagaagggcctagtgagg
gagagggtcgagtggggcgactacaaagtggtgagagagctcaccgaggacgtggctttt
aggcgtggcttgggcgggttcctcgcagagggcgtaatgaggatgagtacggcactcgga
ggcgaggcgctcgagttcgcaatgcacgttaaaggcctcgagatatcggcctacgactgc
cacgcagccccagcgatggcgctcgcatacggcacctcgcctataggtgctcatcacaag
gacgcctggatcataagctacgaggtcaggacggataggctcggatacacgagggagaaa
gtcgagaggcttgtgtaccttcaggacgtgagaggagggatgttcgagtctttaaccgtg
tgtaggctcccgtgggtggagttagggctagacctcgactactacttgaagatgctgagc
cacgtcacgggtatcgagtggagctggggcatgatacgcgaggtcgcaaacaggatctac
acgttgataagggccttctggataagggagttcgacgggtggagcaagtactacgactac
ccgccggctaggtggttcaaacacccgttgactaagggcccgtacaagggtgtcaagcta
gaccctgcgaagtacgagcagatgctccaggagtactacgctctgaggggctgggacagc
aacggcgtaccgaagcccgagaccctcagtaagctcggactcacgttcgtcgaagacacg
ttgaagagagttggagtactggtatga

DBGET integrated database retrieval system