KEGG   Thermogladius cellulolyticus: TCELL_0681Help
Entry
TCELL_0681        CDS       T02127                                 

Definition
(GenBank) peptidase M42 family protein
Organism
thg  Thermogladius cellulolyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
620536..621648
Genome map
AA seq 370 aa AA seqDB search
MVELGKLKEEMYGLLQKLTSVHAPSGFEYLIHDTVISELERHADKVWVDSLGNVIALKKG
SKGGASLMLAAHMDEIGLFVSYIEDDGFLRVTPIGGVLERTLLHQRVVIVTRSGRTVKGV
IGLKPPHVVKPEEAQKIPEIKELFVDIGASSRDDVEKMGVRVGDVAVFDRAMERLAGDRV
TGKAFDDRAGLAVMLKAFQLIENNEADVYAVATVQEEVGLKGARTAAFAISPSVAIALDV
TIASDFPGVAKSEQFTRLGRGPAIKIADGRNASGLITHPEILNFMVKVAEEEKIPYQLEV
IPGGTTDASIIALNKEGVPAGVVSVPARYIHSPTEVIDLNDLAYAVLLTEKIAEKAGVEW
LNRIRMRVVK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacttggtaagttaaaggaggaaatgtacggtttgctccaaaagctgacaagc
gtccacgcaccgagcgggtttgagtacttgattcacgacaccgtgataagcgagctggag
agacacgctgacaaggtgtgggtggactccttgggcaacgtgatcgcgttaaagaaggga
agcaagggtggggccagcctaatgctcgcggcccacatggacgagatagggctgttcgtg
tcctatatagaggacgacggtttcctacgcgtcaccccgataggcggggttcttgagagg
acactactacaccagcgcgtagtcatagtgactagaagcgggaggactgtgaaaggcgtc
ataggcttaaagccccctcatgtagtcaagccggaggaggcccagaagatacctgagata
aaagaactcttcgtagacatcggggcgtcatcgcgggacgatgtggagaaaatgggtgta
agggttggcgacgtagcggtgttcgacagggctatggagaggttggccggggatagagtc
acaggcaaggcgtttgacgatagagcaggcctcgctgtgatgcttaaagccttccagctg
atcgagaacaacgaggccgacgtgtacgctgtggctactgtccaagaggaggtcgggctc
aagggtgcgaggactgccgccttcgctatctcccccagcgtggcgatcgcccttgatgtc
actattgcgagcgacttccccggtgtagcgaagagcgagcagttcacgaggttgggtagg
ggccccgcgatcaaaatagccgacgggaggaacgcgtcaggcctcatcacacaccccgag
atactcaacttcatggtcaaggttgccgaagaggagaagataccctatcagctagaggtc
atacctggggggactactgacgcctcgataatagcgttgaacaaggagggggtaccggca
ggcgttgtctcggtgcctgcgaggtacatacactcccccacggaagtaatagacttgaac
gacctcgcctacgcggtattactcacagaaaagatagccgagaaagcaggtgtcgagtgg
ctcaacagaattaggatgcgagtcgtgaagtag

DBGET integrated database retrieval system