KEGG   Thermogladius cellulolyticus: TCELL_0721Help
Entry
TCELL_0721        CDS       T02127                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
thg  Thermogladius cellulolyticus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TCELL_0721
Enzymes [BR:thg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TCELL_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
657439..658416
Genome map
AA seq 325 aa AA seqDB search
MSGLKRGEKHSLRPVHVSVGNVNVDILFYVDKIPGPDESIYARDLIISPGGAALNYAVAA
TYYGHYAYLVASASNHVLVQKLLEEVKEIGVDTRYVKVVDEQPGVVAVFVTEKGERHMVK
FRGANEFMTLNDIPRNLVKDASVVHLASVAPDIVEGLGTVAKSHGAIVAYDPGLYALETP
EEVVRLSNKINVLYLNRSEARRMGVSNVLQALHRGVDMVVVKRGSEGAVVVTGGMRVLRG
YSEPIRRVINATGAGDAFDAFFNAAYVDWGDPLKALLYALAAGALKTYCRGSTLCWDKHL
FAKQLEKTTVEDQGRVDENKIGDFI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggtttgaaaagaggagaaaaacatagcctgaggcccgtccacgtcagcgtgggc
aacgtaaacgtggacattctgttttacgtagacaaaatacccggccccgacgagtccatc
tacgctagagacttgatcataagtccgggcggggcggcgctaaactacgcggtcgccgca
acgtactacgggcactacgcttacctcgtcgcgtccgcgtccaaccacgttctagtccag
aagttgctcgaggaagtcaaggaaataggggttgacacgaggtacgtcaaggttgtcgac
gagcaaccaggcgtcgtagcagtgtttgtcacagagaagggtgaaaggcacatggtaaag
ttcagaggcgccaacgagttcatgacgttaaacgacatccctagaaacctcgtgaaggac
gcgagcgtggtacacctagcttctgtagcccccgacatcgtagaagggctgggaacagtc
gcgaagtctcacggagcaattgtcgcttacgaccccggactttacgccctcgagacccca
gaagaggtcgttaggctgtccaacaagatcaacgtcctctacctgaacagatcggaggcc
aggagaatgggggtgtccaatgtactccaggctctacacaggggcgtagacatggtggtc
gtcaagagagggagcgagggtgccgttgtagtcacgggtggtatgagagttctcagaggc
tactcggaacctattaggagagtaattaacgcaacgggtgcaggcgacgctttcgacgcc
ttctttaacgccgcttacgtcgactggggtgaccccctcaaggcactcctctacgcgctt
gccgcgggggccctcaagacttactgcagaggtagcacgctatgctgggacaaacacctc
ttcgcgaaacagctcgagaagactaccgtggaggatcaaggtagagttgacgaaaataaa
ataggagacttcatttga

DBGET integrated database retrieval system