KEGG   Thermogladius calderae: TCELL_0778Help
Entry
TCELL_0778        CDS       T02127                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
thg  Thermogladius calderae
Pathway
thg00260  Glycine, serine and threonine metabolism
thg01100  Metabolic pathways
thg01110  Biosynthesis of secondary metabolites
thg01120  Microbial metabolism in diverse environments
thg01230  Biosynthesis of amino acids
Module
thg_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:thg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TCELL_0778
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TCELL_0778
Enzymes [BR:thg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TCELL_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AFK51202
UniProt: I3TEL4
Position
706594..707634
Genome map
AA seq 346 aa AA seqDB search
MPLEVVIKGLRFETSSARGVWKYKLMLPVKKEVEPVSLGEGDTPLIPLKSHKRLFVKFEG
ANPTGSFKDRGMTLAVTIAKYIGAKSVVVASTGNTSASAAAYAAKAGLECLVYLPRGSVA
RGKLFQALLHGAKVVEVDGNFDEALEEVIARYVDNTQGHVYPLNSVNPWRLEGQKTIAFE
IYQQLGFVPENVVVPVGNAGNIYAIWKGFRELREVGVTDRAPRMIGVQAEGASPVFKTWL
AKADELLPVERPYTVATAIKIGRPVNWLKALTAVRESNGFMLSVSDATILEALKTLARSE
GIGVEPASAAPLAGYRVALEQGLIGQDETTVLVATGHALKDPEVRF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcctctcgaggttgtcatcaaggggttgcggttcgagacatcaagtgcgaggggtgtg
tggaagtacaagctgatgttgccggtgaagaaggaagtcgagcctgtatcgctcggtgag
ggcgacacccctctcatacccttgaagagccacaagcggctgtttgtgaaattcgagggc
gcaaaccccacgggaagcttcaaggacaggggtatgaccctagctgtcacgatcgcaaag
tacatcggtgctaaaagcgtcgtggtcgctagcaccggtaacacctcggcatcggcggcc
gcgtacgcggcaaaggctgggctcgagtgcctggtctacttacccaggggctcagtggct
agaggcaagctcttccaagccctactacacggtgccaaggtggtcgaggtggacgggaac
ttcgacgaggctctagaagaggttattgcgaggtatgtcgacaatacccaagggcacgta
taccctctaaactcagtaaacccctggaggctcgaggggcagaagaccatagcgttcgag
atataccaacaactagggttcgtacccgaaaacgtggtcgtacccgtcggtaacgccggc
aatatatacgctatatggaaggggttcagggagctccgcgaggttggggttactgacaga
gcacctaggatgataggcgttcaggccgaaggcgcctcacccgtcttcaagacatggctc
gcaaaagccgacgagctattacccgttgagagaccgtatacggtggctacagcaataaag
atcgggagacccgtgaactggctaaaggccctcactgccgttagggagtcgaacggcttc
atgttatcggtcagcgatgccactatcttggaggcgctcaagacactcgcgaggagcgag
gggatcggcgtagagcccgcctcggcagcaccattagcagggtatagagttgcgctcgag
caggggctgatagggcaggacgagaccactgtgctcgtagccacaggtcacgcgctgaaa
gaccccgaggtaaggttctga

DBGET integrated database retrieval system